Recombinant Human ZNRF1 GST (N-Term) Protein

Name: Recombinant Human ZNRF1 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00084937-P01

Novus Biologicals, part of Bio-Techne | Catalog # H00084937-P01

Submit a review

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

View all ZNRF1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-227 of Human ZNRF1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MGGKQSTAARSRGPFPGVSTDDSAVPPPGGAPHFGHYRTGGGAMGLRSRSVSSVAGMGMDPSTAGGVPFGLYTPASRGTGDSERAPGGGGSASDSTYAHGNGYQETGGGHHRDGMLYLGSRASLADALPLHIAPRWFSSHSGFKCPICSKSVASDEMEMHFIMCLSKPRLSYNDDVLTKDAGECVICLEELLQGDTIARLPCLCIYHKSCIDSWFEVNRSCPEHPAD

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

50.2 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human ZNRF1 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00084937-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: ZNRF1

In a study identifying genes in rat that are upregulated in response to nerve damage, a gene which is highly expressed in ganglia and in the central nervous system was found. The protein encoded by the rat gene contains both a zinc finger and a RING finger motif and is localized in the endosome/lysosome compartment, indicating that it may be involved in ubiquitin-mediated protein modification. The protein encoded by this human gene is highly similar in sequence to that encoded by the rat gene. [provided by RefSeq]

Alternate Names

DKFZp434E229, EC 6.3.2, EC 6.3.2.-, FLJ14846, MGC15430, nerve injury gene 283, Nerve injury-induced gene 283 protein, nin283, NIN283E3 ubiquitin-protein ligase ZNRF1, zinc and ring finger 1, zinc and ring finger protein 1, Zinc/RING finger protein 1

Gene Symbol

ZNRF1

Additional ZNRF1 Products

Product Documents for Recombinant Human ZNRF1 GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human ZNRF1 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews