Bay 55-9837

Name: Bay 55-9837
Brand: Tocris Bioscience
SKU: 2711

Tocris Bioscience, part of Bio-Techne | Catalog # 2711

Citations (9)

COA / SDS

Potent and selective VPAC2 agonist

Key Product Details

Description:	Potent and selective VPAC₂ agonist
Purity:	≥95% (HPLC)
Molecular Weight:	3742.29

View Full Technical Details for Bay 55-9837

Technical Data
Citations

Biological Activity for Bay 55-9837

Bay 55-9837 is a selective VPAC₂ receptor agonist (EC₅₀ values are 0.4, 100 and >1000 nM for VPAC₂, VPAC₁ and PAC₁, respectively in a cAMP accumulation assay; IC₅₀ values are 60, 8700 and >10000 nM for VPAC₂, VPAC₁ and PAC₁, respectively in a competition binding assay). Stimulates glucose-dependent insulin secretion in isolated human pancreatic islets. Reduces HIV-1 viral replication and shows cooperative effects when given in conjunction with VPAC₁ agonists.

Technical Data for Bay 55-9837

M. Wt	3742.29
Formula	C₁₆₇H₂₇₀N₅₂O₄₆
Single Letter Sequence	HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY (Modifications: Tyr-31 = C-terminal amide)
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	463930-25-8
PubChem ID	72941824
InChi Key	NHMJBXFCQMBYCP-ZBLLYJRDSA-N
Smiles	[H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(N)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility for Bay 55-9837

Solubility

Soluble to 2mg/ml in water

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for Bay 55-9837

References are publications that support the biological activity of the product.

Temerozo Macrophage resistance to HIV-1 infection is enhanced by the neuropeptides VIP and PACAP. PLoS ONE 2013 PMID: 23818986
Clairmont Engineering of a VPAC2 receptor peptide agonist to impart dipeptidyl peptidase IV stability and enhance in vivo glucose disposal. J.Med.Chem. 2006 PMID: 17149884
Pan Engineering novel VPAC2-selective agonists with improved stability and glucose-lowering activity in vivo. J.Pharmacol.Exp.Ther. 2007 PMID: 17110523
Tsutsumi A potent and highly selective VPAC2 agonist enhances glucose-induced Ins release and glucose disposal: a potential therapy for type 2 diabetes. Diabetes 2002 PMID: 11978642