Brain natriuretic peptide (1-32) (human)

Name: Brain natriuretic peptide (1-32) (human)
Brand: Tocris Bioscience
SKU: 3522
Rating: 5 (1 reviews)

Tocris Bioscience, part of Bio-Techne | Catalog # 3522

(1)

Citations (2)

COA / SDS

Endogenous peptide agonist at ANP receptor A (NPR1)

Key Product Details

Description:	Endogenous peptide agonist at ANP receptor A (NPR1)
Purity:	≥95% (HPLC)
Molecular Weight:	3464.05

View Full Technical Details for Brain natriuretic peptide (1-32) (human)

Technical Data
Citations / Reviews (1)

Biological Activity for Brain natriuretic peptide (1-32) (human)

Brain natriuretic peptide (1-32) (human) is an endogenous peptide secreted from cardiac ventricles in response to volume increase and pressure overload that acts as an agonist at atrial natriuretic peptide (ANP) receptor A (NRP1). Decreases de novo collagen synthesis and increases MMP gene expression in vitro. Exhibits natriuretic, vasodilatory and lusitropic activity and inhibits the sympathetic and renin-angiotensin-aldosterone systems in vivo.

Technical Data for Brain natriuretic peptide (1-32) (human)

M. Wt	3464.05
Formula	C₁₄₃H₂₄₄N₅₀O₄₂S₄
Single Letter Sequence	SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Modification: Disulfide bridge: 10-26)
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	124584-08-3
PubChem ID	53325981
InChi Key	HPNRHPKXQZSDFX-OAQDCNSJSA-N
Smiles	[H]N[C@@H](CO)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@H]1CSSC[C@H](NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(N)=N)NC(=O)CNC(=O)[C@H](CC2=CC=CC=C2)NC1=O)[C@@H](C)CC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC=N1)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility for Brain natriuretic peptide (1-32) (human)

Solubility

Soluble to 0.1mg/ml in water

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for Brain natriuretic peptide (1-32) (human)

References are publications that support the biological activity of the product.

Wellard Natriuretic peptides, but not nitric oxide donors, elevate levels of cytosolic guanosine 3',5'-cyclic monophosphate in ependymal cells ex vivo. Neurosci.Lett. 2006 PMID: 16278044
Heublein Immunoreactivity and guanosine 3',5'-cyclic monophosphate activating actions of various forms of human B-type natriuretic peptide. Hypertension 2007 PMID: 17372040
Tsuruda Brain natriuretic peptide is produced in cardiac fibroblasts and induces matrix metalloproteinases. Circ.Res. 2002 PMID: 12480813