PACAP 6-38

Name: PACAP 6-38
Brand: Tocris Bioscience
SKU: 3236

Tocris Bioscience, part of Bio-Techne | Catalog # 3236

Citations (20)

COA / SDS

Potent PAC1 receptor antagonist

Key Product Details

Description:	Potent PAC₁ receptor antagonist
Purity:	≥95% (HPLC)
Molecular Weight:	4024.78

View Full Technical Details for PACAP 6-38

Technical Data
Citations

Biological Activity for PACAP 6-38

PACAP 6-38 is a potent and competitive pituitary adenylate cyclase-activating polypeptide receptor (PAC)₁ antagonist (IC₅₀ = 2 nM). Inhibits PACAP(1-27)-induced stimulation of adenylate cyclase (K_i = 1.5 nM). Antitumor activity in vivo.

Technical Data for PACAP 6-38

M. Wt	4024.78
Formula	C₁₈₂H₃₀₀N₅₆O₄₅S
Single Letter Sequence	FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK (Modifications: Lys-33 = C-terminal amide)
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	143748-18-9
PubChem ID	24868185
InChi Key	BGZYREVJBMQLGS-ONKNJJKASA-N
Smiles	[H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(N)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility for PACAP 6-38

Solubility

Soluble to 2mg/ml in water

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for PACAP 6-38

References are publications that support the biological activity of the product.

Leyton PACAP(6-38) inhibits growth of prostate cancer cells. Cancer Lett. 1998 PMID: 9566707
Kojro The neuropeptide PACAP promotes a-secretase pathway for processing Alzheimer amyloid precursor protein. FASEB J. 2006 PMID: 16401644
Robberecht Structural requirements for the occupancy of pituitary adenylate-cyclase-activating-peptide (PACAP) receptors and adenylate cyclase activation in human neuroblastoma NB-OK-1 cell membranes. Discovery of PACAP(6-38) as a potent antagonist. Eur.J.Biochem. 1992 PMID: 1321043