Parathyroid hormone (1-34) (human)

Name: Parathyroid hormone (1-34) (human)
Brand: Tocris Bioscience
SKU: 3011

Tocris Bioscience, part of Bio-Techne | Catalog # 3011

Citations (3)

COA / SDS

Parathyroid hormone (PTH) receptor agonist

Key Product Details

Description:	Parathyroid hormone (PTH) receptor agonist
Alternative Names:	PTH 1-34,hPTH (1-34),Teriparatide
Purity:	≥95% (HPLC)
Molecular Weight:	4117.75

View Full Technical Details for Parathyroid hormone (1-34) (human)

Technical Data
Citations

Biological Activity for Parathyroid hormone (1-34) (human)

Parathyroid hormone (1-34) (human) is a human parathyroid hormone (hPTH) peptide fragment; contains the 34 N-terminal residues of hPTH. Agonist at parathyroid 1 (PTH1) and parathyroid 2 (PTH2) receptors.

Technical Data for Parathyroid hormone (1-34) (human)

M. Wt	4117.75
Formula	C₁₈₁H₂₉₁N₅₅O₅₁S₂
Single Letter Sequence	SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	52232-67-4
PubChem ID	16132393
InChi Key	OGBMKVWORPGQRR-UMXFMPSGSA-N
Smiles	[H]N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility for Parathyroid hormone (1-34) (human)

Solubility

Soluble to 0.4mg/ml in water

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for Parathyroid hormone (1-34) (human)

References are publications that support the biological activity of the product.

Manabe Human parathyroid hormone (1-34) accelerates natural fracture healing process in the femoral osteotomy model of cynomolgus monkeys. Bone 2007 PMID: 17369013
Niall The amino acid sequence of the amino-terminal 37 residues of human parathyroid hormone. Proc.Natl.Acad.Sci.
Dobnig and Turner The effects of programmed administration of human parathyroid hormone fragment (1-34) on bone histomorphometry and serum chemistry in rats. Endocrinology 1997 PMID: 9348185

Product Documents for Parathyroid hormone (1-34) (human)

COA

Certificate of Analysis

To download a Certificate of Analysis, please select a batch below.

SDS

⚠ WARNING: This product can expose you to chemicals including Teriparatide, which is known to the State of California to cause cancer. For more information, go to www.P65Warnings.ca.gov