Parstatin (human)

Name: Parstatin (human)
Brand: Tocris Bioscience
SKU: 3553

Tocris Bioscience, part of Bio-Techne | Catalog # 3553

COA / SDS

Peptide cleaved from PAR1 upon receptor activation

Discontinued Product

3553 has been discontinued. View all Additional Protease-Activated Receptor Peptides products.

Key Product Details

Description:	Peptide cleaved from PAR₁ upon receptor activation
Molecular Weight:	4467.29

View Full Technical Details for Parstatin (human)

Technical Data
Citations

Biological Activity for Parstatin (human)

Parstatin (human) is a cell-permeable peptide cleaved from protease-activated receptor 1 (PAR₁) upon receptor activation. Attenuates endothelial cell migration and proliferation (IC₅₀ ~ 3 μM), and induces cell cycle arrest. Promotes activation of caspase-3 and exhibits pro-apoptotic activity in vitro. Inhibits angiogenesis and exhibits cardioprotective activity in vivo.

Parstatin (mouse) also available.

Technical Data for Parstatin (human)

M. Wt	4467.29
Formula	C₁₉₁H₃₃₀N₆₄O₅₃S₃
Single Letter Sequence	MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPR
Storage	Store at -20°C
CAS Number	1065755-99-8
PubChem ID	90488856
InChi Key	SVAINNLHALEEHP-HQNSSEMESA-N
Smiles	[H]N[C@@H](CCSC)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CS)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CS)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for Parstatin (human)

References are publications that support the biological activity of the product.

Strande Parstatin: a cryptic peptide involved in cardioprotection after ischaemic and reperfusion injury. Cardiovasc.Res. 2009 PMID: 19380418
Zania Parstatin, the cleaved peptide on proteinase-activated receptor 1 activation, is a potent inhibitor of activation. J.Pharmacol.Exp.Ther. 2009 PMID: 18988770

Parstatin (human)

Tocris Bioscience, part of Bio-Techne | Catalog # 3553

Key Product Details

Biological Activity for Parstatin (human)

Technical Data for Parstatin (human)

Molarity Calculator

Dilution Calculator

Reconstitution Calculator

References for Parstatin (human)

Product Documents for Parstatin (human)

COA

Certificate of Analysis

SDS

CONTACT INFORMATION

Stay Connected