ω-Agatoxin IVA

Name: ω-Agatoxin IVA
Brand: Tocris Bioscience
SKU: 2799
Rating: 5 (1 reviews)

Tocris Bioscience, part of Bio-Techne | Catalog # 2799

(1)

Citations (7)

COA / SDS

CaV2.1 blocker

Key Product Details

Description:	Ca_V2.1 blocker
Alternative Names:	ω-Aga-IV A
Purity:	≥95% (HPLC)
Molecular Weight:	5202.25

View Full Technical Details for ω-Agatoxin IVA

Technical Data
Citations / Reviews (1)

Biological Activity for ω-Agatoxin IVA

ω-Agatoxin IVA is a selective blocker of P-type calcium channels (IC₅₀ < 1 - 3 nM). Also inhibits N-type channels at micromolar concentrations.

Technical Data for ω-Agatoxin IVA

M. Wt	5202.25
Formula	C₂₁₇H₃₆₀N₆₈O₆₀S₁₀
Single Letter Sequence	KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA (Modifications: Disulfide bridges: 4-20, 12-25, 19-36, 27-34)
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	145017-83-0
PubChem ID	56841669
InChi Key	NVVFOMZVLALQKT-JYRRICCISA-N
Smiles	[H]N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H]4CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)CNC(=O)[C@H](CC5=CC=C(O)C=C5)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@@H](NC1=O)[C@@H](C)CC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CNC5=C1C=CC=C5)C(=O)NCC(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N1CCC[C@H]1C(=O)N3)NC(=O)CNC(=O)[C@H](CCCNC(N)=N)NC(=O)CNC(=O)[C@H](CCCNC(N)=N)NC2=O)[C@@H](C)CC)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCSC)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N4)C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility for ω-Agatoxin IVA

Solubility

Soluble to 1mg/ml in water

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for ω-Agatoxin IVA

References are publications that support the biological activity of the product.

Tringham Protease treatment of cerebellar purkinje cells renders ω-agatoxin IVA-sensitive Ca²⁺ channels insensitive to inhibition by ω-conotoxin GVIA. J.Pharmacol.Exp.Ther. 2008 PMID: 17975010
Turner Calcium channels coupled to glutamate release identified by ω-Aga-IVA. Science 1992 PMID: 1357749
Bourinet Splicing of α_1A subunit gene generates phenotypic variants of P- and Q-type calcium channels. Nat.Neurosci. 1999 PMID: 10321243
Mintz P-type calcium channels blocked by the spider toxin ω-Aga-IVA. Nature 1992 PMID: 1311418