ACADL Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-54936

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-54936
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Simple Western, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all ACADL Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ACADL(acyl-Coenzyme A dehydrogenase, long chain) The peptide sequence was selected from the N terminal of ACADL. Peptide sequence MAARLLRGSLRVLGGHRAPRQLPAARCSHSGGEERLETPSAKKLTDIGIR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ACADL Antibody

Western Blot: ACADL Antibody [NBP1-54936]

Western Blot: ACADL Antibody [NBP1-54936]

Western Blot: ACADL Antibody [NBP1-54936] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.

Applications for ACADL Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Application Notes
See Simple Western Antibody Database for Simple Western validation: tested in rat/mouse liver; antibody dilution of 1:50; separated by size; detects a band at 48 kDa

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACADL

ACADL belongs to the acyl-CoA dehydrogenase family, which is a family of mitochondrial flavoenzymes involved in fatty acid and branched chain amino-acid metabolism. This protein is one of the four enzymes that catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid. Defects in ACADL gene are the cause of long-chain acyl-CoA dehydrogenase (LCAD) deficiency, leading to nonketotic hypoglycemia.The protein encoded by this gene belongs to the acyl-CoA dehydrogenase family, which is a family of mitochondrial flavoenzymes involved in fatty acid and branched chain amino-acid metabolism. This protein is one of the four enzymes that catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid. Defects in this gene are the cause of long-chain acyl-CoA dehydrogenase (LCAD) deficiency, leading to nonketotic hypoglycemia.

Alternate Names

ACAD4, acyl-CoA dehydrogenase, long chain, acyl-Coenzyme A dehydrogenase, long chain, EC 1.3.99, EC 1.3.99.13, LCADFLJ94052, long-chain specific acyl-CoA dehydrogenase, mitochondrial

Gene Symbol

ACADL

UniProt

P28330 (Human)

Additional ACADL Products

Product Documents for ACADL Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for ACADL Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.