ACADVL Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-54378

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-54378
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all ACADVL Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ACADVL(acyl-Coenzyme A dehydrogenase, very long chain) The peptide sequence was selected from the N terminal of ACADVL (NP_001029031). Peptide sequence RPYAGGAAQESKSFAVGMFKGQLTTDQVFPYPSVLNEEQTQFLKELVEPV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ACADVL Antibody

Western Blot: ACADVL Antibody [NBP1-54378]

Western Blot: ACADVL Antibody [NBP1-54378]

Western Blot: ACADVL Antibody [NBP1-54378] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml

Immunohistochemistry-Paraffin: ACADVL Antibody [NBP1-54378] -

Immunohistochemistry-Paraffin: ACADVL Antibody [NBP1-54378] - Formalin Fixed Paraffin; Embedded Tissue: Human Pineal Tissue; Observed Staining: Cytoplasmic in cell bodies of pinealocytes; Primary Antibody Concentration: 1:100
Western Blot: ACADVL Antibody [NBP1-54378]

Western Blot: ACADVL Antibody [NBP1-54378]

Western Blot: ACADVL Antibody [NBP1-54378] - Lanes: 1 : Normal controls Normal enzyme expression 2: Normal controls Normal enzyme expression 3: Positive mutants Defective enzyme expression 4: Positive mutants Defective enzyme expression 5: Positive mutants Defective enzyme expression Primary Antibody Dilution: 1 : 2000 Secondary Antibody: Secondary Antibody Dilution: 1 : 1000 Gene name: ACADVL Submitted by: David Lombert, Medical College of Wisconsin.
View 3 more images

Applications for ACADVL Antibody

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACADVL

ACADVL is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in ACADVL protein reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy.The protein encoded by this gene is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in this gene product reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy. Alternative splicing results in multiple transcript variants encoding different isoforms.

Alternate Names

ACAD6, acyl-CoA dehydrogenase, very long chain, acyl-Coenzyme A dehydrogenase, very long chain, EC 1.3.99, EC 1.3.99.-, LCACD, very long-chain specific acyl-CoA dehydrogenase, mitochondrial, VLCAD

Entrez Gene IDs

37 (Human)

Gene Symbol

ACADVL

UniProt

P49748 (Human)

Additional ACADVL Products

Product Documents for ACADVL Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for ACADVL Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.