ACSL1 Antibody - Azide and BSA Free
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-92757
Key Product Details
Species Reactivity
Validated:
Human, Mouse, Rat
Applications
ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
Azide and BSA Free
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Product Summary for ACSL1 Antibody - Azide and BSA Free
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 46-145 of human ACSL1 (NP_001986.2). TRPKPLKPPCDLSMQSVEVAGSGGARRSALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSYKQVAELSECIGSALIQKGFKTA
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
78 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for ACSL1 Antibody - Azide and BSA Free
Western Blot: ACSL1 AntibodyAzide and BSA Free [NBP2-92757]
Western Blot: ACSL1 Antibody [NBP2-92757] - Western blot analysis of extracts of various cell lines, using ACSL1 antibody (NBP2-92757) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.Immunocytochemistry/ Immunofluorescence: ACSL1 Antibody - Azide and BSA Free [NBP2-92757]
Immunocytochemistry/Immunofluorescence: ACSL1 Antibody [NBP2-92757] - Immunofluorescence analysis of NIH-3T3 cells using ACSL1 Rabbit pAb (NBP2-92757) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.Immunocytochemistry/ Immunofluorescence: ACSL1 Antibody - Azide and BSA Free [NBP2-92757]
Immunocytochemistry/Immunofluorescence: ACSL1 Antibody [NBP2-92757] - Immunofluorescence analysis of C6 cells using ACSL1 Rabbit pAb (NBP2-92757) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.Applications for ACSL1 Antibody - Azide and BSA Free
Application
Recommended Usage
ELISA
Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Immunoprecipitation
0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Western Blot
1:500 - 1:1000
Please Note: Optimal dilutions of this antibody should be experimentally determined.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
Azide and BSA Free
Preservative
0.05% Proclin 300
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: ACSL1
ALCS1 is strongly expressed in the heart, kindey, liver, skeletal muscle, and erythroid cells, and to a lesser extent in lung, brain, placenta and pancreas. This protein is predominantly expressed during the early stages of erythroid development, and expression is weak in reticulocytes and young erythrocytes.
Alternate Names
ACS1LACS 2, Acyl-CoA synthetase 1, acyl-CoA synthetase long-chain family member 1, EC 6.2.1, FACL1EC 6.2.1.3, fatty-acid-Coenzyme A ligase, long-chain 1, LACS 1, LACSlong-chain 2, lignoceroyl-CoA synthase, Long-chain acyl-CoA synthetase 1, Long-chain acyl-CoA synthetase 2, Long-chain fatty acid-CoA ligase 2, long-chain fatty-acid-coenzyme A ligase 1, long-chain-fatty-acid--CoA ligase 1, Palmitoyl-CoA ligase 1, Palmitoyl-CoA ligase 2, paltimoyl-CoA ligase 1
Gene Symbol
ACSL1
Additional ACSL1 Products
Product Documents for ACSL1 Antibody - Azide and BSA Free
Product Specific Notices for ACSL1 Antibody - Azide and BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov