ADAM19 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-69364

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-69364
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Cited:

Human, Mouse

Applications

Validated:

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Western Blot

Cited:

IF/IHC, Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all ADAM19 Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ADAM19(ADAM metallopeptidase domain 19 (meltrin beta)) The peptide sequence was selected from the N terminal of ADAM19 (NP_075525). Peptide sequence VADYLEFQKNRRDQDATKHKLIEIANYVDKFYRSLNIRIALVGLEVWTHG. The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 22930161).

Marker

Dendritic Cell Marker

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

82 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ADAM19 Antibody

Western Blot: ADAM19 Antibody [NBP1-69364]

Western Blot: ADAM19 Antibody [NBP1-69364]

Western Blot: ADAM19 Antibody [NBP1-69364] - This Anti-ADAM19 antibody was used in Western Blot of Fetal Muscle tissue lysate at a concentration of 1ug/ml.
Western Blot: ADAM19 Antibody [NBP1-69364]

Western Blot: ADAM19 Antibody [NBP1-69364]

Western Blot: ADAM19 Antibody [NBP1-69364] - Analysis of ADAM19 in HeLa whole cell lyaste (30ug) using anti-ADAM19 antibody. Image from verified customer review.
ADAM19 Antibody

Western Blot: ADAM19 Antibody [NBP1-69364] -

Western Blot: ADAM19 Antibody [NBP1-69364] - ADAM10 is upregulated in experimental heart injury as well as patients w/ ischemic cardiomyopathy & correlates w/ ANP/ BNP expression.a WB analysis & b quantification of indicated ADAMs in heart tissue lysates of sham-operated (Sham) & LAD-ligated (MI) mice 3 days after infarction (n = 5, mean ± SEM, ns not significant, *P < 0.05, two-tailed Mann–Whitney test). Exact P-values: ADAM8, 0.150794. ADAM10, 0.015873. ADAM12, 0.150794. ADAM17, 0.690476. ADAM19, 0.690476. Image collected & cropped by CiteAb from following publication (https://pubmed.ncbi.nlm.nih.gov/36496449), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for ADAM19 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:10-1:500

Immunohistochemistry

1:10-1:500

Western Blot

1.0 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence and Immunohistochemistry were reported in scientific literature.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Reviewed Applications

Read 1 review rated 5 using NBP1-69364 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ADAM19

ADAM19 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a type I transmembrane protein and serves as a marker for dendritic cell differentiation. It has also been demonstrated to be an active metalloproteinase, which may be involved in normal physiological and pathological processes such as cells migration, cell adhesion, cell-cell and cell-matrix interactions, and signal transduction. Alternative splicing results in two transcript variants.This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a type I transmembrane protein and serves as a marker for dendritic cell differentiation. It has also been demonstrated to be an active metalloproteinase, which may be involved in normal physiological and pathological processes such as cells migration, cell adhesion, cell-cell and cell-matrix interactions, and signal transduction. Alternative splicing results in two transcript variants.

Long Name

A Disintegrin and Metalloprotease-like Domain 19

Alternate Names

Meltrin beta

Entrez Gene IDs

8728 (Human)

Gene Symbol

ADAM19

UniProt

Q9H013

Additional ADAM19 Products

Product Documents for ADAM19 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for ADAM19 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.