ADAM30 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-69319

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-69319
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

1 mg/ml

View all ADAM30 Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ADAM30(ADAM metallopeptidase domain 30) The peptide sequence was selected from the N terminal of ADAM30. Peptide sequence RLLLPRHLRVFSFTEHGELLEDHPYIPKDCNYMGSVKESLDSKATISTCM. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

66 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ADAM30 Antibody

Western Blot: ADAM30 Antibody [NBP1-69319]

Western Blot: ADAM30 Antibody [NBP1-69319]

Western Blot: ADAM30 Antibody [NBP1-69319] - This Anti-ADAM30 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 5ug/ml.

Applications for ADAM30 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ADAM30

ADAM30 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. ADAM30 gene is testis-specific and contains a polymorphic region, resulting in isoforms with varying numbers of C-terminal repeats.This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This gene is testis-specific and contains a polymorphic region, resulting in isoforms with varying numbers of C-terminal repeats.

Alternate Names

a disintegrin and metalloproteinase domain 30, ADAM 30, ADAM metallopeptidase domain 30, disintegrin and metalloproteinase domain-containing protein 30, EC 3.4.24.-, svph4

Gene Symbol

ADAM30

UniProt

Q9UKF2 (Human)

Additional ADAM30 Products

Product Documents for ADAM30 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for ADAM30 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.