Adenine Nucleotide Translocase 1/2/3/4 Antibody - Azide and BSA Free
Novus Biologicals, part of Bio-Techne | Catalog # NBP3-05640
![Immunohistochemistry-Paraffin: Adenine Nucleotide Translocase 1/2/3/4 Antibody - Azide and BSA Free [NBP3-05640]](https://resources.bio-techne.com/images/products/Adenine-Nucleotide-Translocase-1-2-3-4-Antibody-Immunohistochemistry-Paraffin-NBP3-05640-img0003.jpg "Immunohistochemistry-Paraffin: Adenine Nucleotide Translocase 1/2/3/4 Antibody - Azide and BSA Free [NBP3-05640]")
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
Azide and BSA Free
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human ANT1 (NP_001142.2). GMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Adenine Nucleotide Translocase 1/2/3/4 Antibody - Azide and BSA Free
![Western Blot: Adenine Nucleotide Translocase 1/2/3/4 AntibodyAzide and BSA Free [NBP3-05640]](https://resources.bio-techne.com/images/products/Adenine-Nucleotide-Translocase-1-2-3-4-Antibody-Western-Blot-NBP3-05640-img0001.jpg "Western Blot: Adenine Nucleotide Translocase 1/2/3/4 AntibodyAzide and BSA Free [NBP3-05640]")
Western Blot: Adenine Nucleotide Translocase 1/2/3/4 AntibodyAzide and BSA Free [NBP3-05640]
Western Blot: Adenine Nucleotide Translocase 1/2/3/4 Antibody [NBP3-05640] - Analysis of extracts of various cell lines, using ANT1/ANT2/ANT3/ANT4 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit. Exposure time: 150s.![Immunohistochemistry-Paraffin: Adenine Nucleotide Translocase 1/2/3/4 Antibody - Azide and BSA Free [NBP3-05640]](https://resources.bio-techne.com/images/products/Adenine-Nucleotide-Translocase-1-2-3-4-Antibody-Immunohistochemistry-Paraffin-NBP3-05640-img0004.jpg "Immunohistochemistry-Paraffin: Adenine Nucleotide Translocase 1/2/3/4 Antibody - Azide and BSA Free [NBP3-05640]")
Immunohistochemistry-Paraffin: Adenine Nucleotide Translocase 1/2/3/4 Antibody - Azide and BSA Free [NBP3-05640]
Immunohistochemistry-Paraffin: Adenine Nucleotide Translocase 1/2/3/4 Antibody [NBP3-05640] - Immunohistochemistry of paraffin-embedded Human colon carcinoma using Adenine Nucleotide Translocase 1/2/3/4 Rabbit pAb (NBP3-05640) at dilution of 1:50 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.![Immunohistochemistry-Paraffin: Adenine Nucleotide Translocase 1/2/3/4 Antibody - Azide and BSA Free [NBP3-05640]](https://resources.bio-techne.com/images/products/Adenine-Nucleotide-Translocase-1-2-3-4-Antibody-Immunohistochemistry-Paraffin-NBP3-05640-img0002.jpg "Immunohistochemistry-Paraffin: Adenine Nucleotide Translocase 1/2/3/4 Antibody - Azide and BSA Free [NBP3-05640]")
Immunohistochemistry-Paraffin: Adenine Nucleotide Translocase 1/2/3/4 Antibody - Azide and BSA Free [NBP3-05640]
Immunohistochemistry-Paraffin: Adenine Nucleotide Translocase 1/2/3/4 Antibody [NBP3-05640] - Immunohistochemistry of paraffin-embedded Mouse kidney using Adenine Nucleotide Translocase 1/2/3/4 Rabbit pAb (NBP3-05640) at dilution of 1:50 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.Applications for Adenine Nucleotide Translocase 1/2/3/4 Antibody - Azide and BSA Free
Application
Recommended Usage
Immunohistochemistry
1:50-1:200
Western Blot
1:500-1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS with 50% glycerol, pH7.3.
Format
Azide and BSA Free
Preservative
0.01% Thimerosal
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Adenine Nucleotide Translocase 1/2/3/4
Alternate Names
2F1, AAC1, AAC2, AAC3, AAC4, adenine nucleotide translocase 4, adenine nucleotide translocator 1 (skeletal muscle), adenine nucleotide translocator 2 (fibroblast), Adenine nucleotide translocator 3, Adenine nucleotide translocator 4, ADP,ATP carrier protein 1, ADP,ATP carrier protein 3, ADP,ATP carrier protein 4, ADP,ATP carrier protein, fibroblast isoform, ADP,ATP carrier protein, heart/skeletal muscle, ADP,ATP carrier protein, isoform T2, ADP,ATP carrier protein, liver, ADP/ATP translocase 1, ADP/ATP translocase 2, ADP/ATP translocase 3, ADP/ATP translocase 4, ADP/ATP translocator of liver, ANT, ANT 1, ANT 2, ANT 3, ANT 4, ANT1, ANT2, ANT3, ANT3Y, ANT4, epididymis secretory sperm binding protein, heart/skeletal muscle ATP/ADP translocator, MTDPS12, MTDPS12A, PEO2, PEO3, PEOA2, SFEC35kDa, solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31, solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4, solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5, solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6, Sperm flagellar energy carrier protein, T1, T2, T3
Gene Symbol
SLC25A4
Additional Adenine Nucleotide Translocase 1/2/3/4 Products
Product Documents for Adenine Nucleotide Translocase 1/2/3/4 Antibody - Azide and BSA Free
Product Specific Notices for Adenine Nucleotide Translocase 1/2/3/4 Antibody - Azide and BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov