Adenylate Cyclase 6 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-59023

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-59023
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all Adenylate Cyclase 6 Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ADCY6(adenylate cyclase 6) The peptide sequence was selected from the C terminal of ADCY6 (NP_066193). Peptide sequence LIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKY. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

125 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Adenylate Cyclase 6 Antibody

Western Blot: Adenylate Cyclase 6 Antibody [NBP1-59023]

Western Blot: Adenylate Cyclase 6 Antibody [NBP1-59023]

Western Blot: Adenylate Cyclase 6 Antibody [NBP1-59023] - Sample Tissue: Human Fetal Kidney Antibody Dilution: 1.0 ug/ml
Western Blot: Adenylate Cyclase 6 Antibody [NBP1-59023]

Western Blot: Adenylate Cyclase 6 Antibody [NBP1-59023]

Western Blot: Adenylate Cyclase 6 Antibody [NBP1-59023] - Hela cell lysate, concentration 0.2-1 ug/ml.

Applications for Adenylate Cyclase 6 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Adenylate Cyclase 6

ADCY6 is adenylate cyclase 6, which is a membrane-associated enzyme and catalyzes the formation of the secondary messenger cyclic adenosine monophosphate (cAMP). The expression of ADCY6 is found in normal thyroid and brain tissues, as well as some tumors; and its expression is significantly higher in one hyperfunctioning thyroid tumor than in normal thyroid tissue.This gene encodes adenylate cyclase 6, which is a membrane-associated enzyme and catalyzes the formation of the secondary messenger cyclic adenosine monophosphate (cAMP). The expression of this gene is found in normal thyroid and brain tissues, as well as some tumors; and its expression is significantly higher in one hyperfunctioning thyroid tumor than in normal thyroid tissue. Alternative splicing generates 2 transcript variants.

Long Name

Adenylate cyclase type 6

Alternate Names

ADCY6, Adenylyl cyclase 6, KIAA0422

Entrez Gene IDs

112 (Human)

Gene Symbol

ADCY6

UniProt

O43306 (Human)

Additional Adenylate Cyclase 6 Products

Product Documents for Adenylate Cyclase 6 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Adenylate Cyclase 6 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.