alcohol dehydrogenase 1B Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-86573

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-86573-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

1 mg/ml

View all alcohol dehydrogenase 1B Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human alcohol dehydrogenase 1B. Peptide sequence: NLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for alcohol dehydrogenase 1B Antibody

Western Blot: alcohol dehydrogenase 1B Antibody [NBP2-86573]

Western Blot: alcohol dehydrogenase 1B Antibody [NBP2-86573]

Western Blot: alcohol dehydrogenase 1B Antibody [NBP2-86573] - WB Suggested Anti-ADH1B Antibody Titration: 1.25ug/ml. Positive Control: Jurkat cell lysate
Immunohistochemistry-Paraffin: alcohol dehydrogenase 1B Antibody [NBP2-86573]

Immunohistochemistry-Paraffin: alcohol dehydrogenase 1B Antibody [NBP2-86573]

Immunohistochemistry-Paraffin: alcohol dehydrogenase 1B Antibody [NBP2-86573] - Rabbit Anti-ADH1B Antibody. Paraffin Embedded Tissue: Human Kidney. Cellular Data: Epithelial cells of renal tubule. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X

Applications for alcohol dehydrogenase 1B Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: alcohol dehydrogenase 1B

alcohol dehydrogenase 1B is encoded by this gene is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. This encoded protein, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism. Three genes encoding alpha, beta and gamma subunits are tandemly organized in a genomic segment as a gene cluster.

Alternate Names

ADH, beta subunit, ADH2alcohol dehydrogenase 1B, alcohol dehydrogenase 1B (class I), beta polypeptide, alcohol dehydrogenase 2 (class I), beta polypeptide, Alcohol dehydrogenase subunit beta, aldehyde reductase, DKFZp686C06125, EC 1.1.1, EC 1.1.1.1

Gene Symbol

ADH1B

Additional alcohol dehydrogenase 1B Products

Product Documents for alcohol dehydrogenase 1B Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for alcohol dehydrogenase 1B Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.