Skip to main content

Aldo-keto Reductase 1C3/AKR1C3 Antibody (7T10F5)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16288

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-16288-100ul
NBP3-16288-20ul

Key Product Details

Species Reactivity

Human, Mouse

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7T10F5

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Aldo-keto Reductase 1C3/AKR1C3 (P42330). SKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLD

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Aldo-keto Reductase 1C3/AKR1C3 Antibody (7T10F5)

Western Blot: Aldo-keto Reductase 1C3/AKR1C3 Antibody (7T10F5) [NBP3-16288]

Western Blot: Aldo-keto Reductase 1C3/AKR1C3 Antibody (7T10F5) [NBP3-16288]

Western Blot: Aldo-keto Reductase 1C3/AKR1C3 Antibody (7T10F5) [NBP3-16288] - Western blot analysis of extracts of various cell lines, using Aldo-keto Reductase 1C3/AKR1C3 Rabbit mAb (NBP3-16288) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Aldo-keto Reductase 1C3/AKR1C3 Antibody (7T10F5)

Immunocytochemistry/Immunofluorescence: Aldo-keto Reductase 1C3/AKR1C3 Antibody (7T10F5) [NBP3-16288] -

Immunocytochemistry/Immunofluorescence: Aldo-keto Reductase 1C3/AKR1C3 Antibody (7T10F5) [NBP3-16288] - Confocal imaging of A549 cells using AKR1C3 Rabbit mAb (dilution 1:100) (Red). The cells were counterstained with alpha-Tubulin Mouse mAb (dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
Aldo-keto Reductase 1C3/AKR1C3 Antibody (7T10F5)

Immunocytochemistry/ Immunofluorescence: Aldo-keto Reductase 1C3/AKR1C3 Antibody (7T10F5) [NBP3-16288] -

Immunocytochemistry/ Immunofluorescence: Aldo-keto Reductase 1C3/AKR1C3 Antibody (7T10F5) [NBP3-16288] - Confocal imaging of A549 cells using Aldo-keto Reductase 1C3/AKR1C3 Rabbit mAb. The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Applications for Aldo-keto Reductase 1C3/AKR1C3 Antibody (7T10F5)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Aldo-keto Reductase 1C3/AKR1C3

AKR1C3 encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reduction of prostaglandin (PG) D2, PGH2 and phenanthrenequinone (PQ), and the oxidation of 9alpha,11beta-PGF2 to PGD2. It may play an important role in the pathogenesis of allergic diseases such as asthma, and may also have a role in controlling cell growth and/or differentiation. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14.

Long Name

Aldo-keto Reductase Family 1, Member C3

Alternate Names

AKR1C3, AldoketoReductase 1C3, DD3, DDX, HA1753, HAKRB, HSD17B5, PGFS

Gene Symbol

AKR1C3

Additional Aldo-keto Reductase 1C3/AKR1C3 Products

Product Documents for Aldo-keto Reductase 1C3/AKR1C3 Antibody (7T10F5)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Aldo-keto Reductase 1C3/AKR1C3 Antibody (7T10F5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...