Androgen R/NR3C4 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-55999

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-55999
NBP2-55999-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all Androgen R/NR3C4 Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAGKSTEDTAEYSPFKGGYTKGLEG

Reactivity Notes

Mouse 83%, Rat 83%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Androgen R/NR3C4 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Androgen R/NR3C4 Antibody [NBP2-55999]

Immunocytochemistry/ Immunofluorescence: Androgen R/NR3C4 Antibody [NBP2-55999]

Immunocytochemistry/Immunofluorescence: Androgen R/NR3C4 Antibody [NBP2-55999] - Staining of human cell line U-2 OS shows localization to mitochondria.

Applications for Androgen R/NR3C4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Androgen R/NR3C4

Androgens have a broad range of effects on the appearance and maintenance of male secondary sexual characteristics. Like other members of the steroid superfamily, the androgen receptor (AR) consists of an amino terminal modulating domain, a central DNA binding domain, a hinge region and a carboxy terminal ligand binding domain. The androgen receptor (AR) is a 110 kDa androgen-dependent transcription factor that is a member of the steroid/nuclear receptor gene superfamily. The AR signaling pathway plays a key role in development and function of male reproductive organs, including the prostate and epididymis. AR also plays a role in nonreproductive organs, such as muscle, hair follicles, and brain. Abnormalities in the AR signaling pathway have been linked to a number of diseases, including prostate cancer, Kennedy's disease and male infertility. The PI3K/Akt signaling pathway plays an important role in regulating AR activity through phosphorylation of AR at Ser213/210 and Ser791/790. Growth factors or cytokines may induce phosphorylation of AR through the PI3K/Akt pathway. Activation of the PI3K/AKt pathway is thought to have a survival role in prostate cancer by protecting cells from apoptosis.

Long Name

Androgen Receptor

Alternate Names

AIS, AndrogenR, AR, DHTR, NR3C4, SBMA, SMAX1

Gene Symbol

AR

Additional Androgen R/NR3C4 Products

Product Documents for Androgen R/NR3C4 Antibody - BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Androgen R/NR3C4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.