Angiopoietin-1 Antibody (6C4S7)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16269

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16269-100ul
NBP3-16269-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 6C4S7

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Angiopoietin-1 Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Angiopoietin-1 (Q15389). EMEGKHKEELDTLKEEKENLQGLVTRQTYIIQELEKQLNRATTNNSVLQKQQLELMDTVHNLVNLCTKEGVLLKGGKREEEKPFRDCADVYQAGFNKSGIY

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Angiopoietin-1 Antibody (6C4S7)

Western Blot: Angiopoietin-1 Antibody (6C4S7) [NBP3-16269]

Western Blot: Angiopoietin-1 Antibody (6C4S7) [NBP3-16269]

Western Blot: Angiopoietin-1 Antibody (6C4S7) [NBP3-16269] - Western blot analysis of extracts of various cell lines, using Angiopoietin-1 Rabbit mAb (NBP3-16269) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 3min.
Immunohistochemistry-Paraffin: Angiopoietin-1 Antibody (6C4S7) [NBP3-16269]

Immunohistochemistry-Paraffin: Angiopoietin-1 Antibody (6C4S7) [NBP3-16269]

Immunohistochemistry-Paraffin: Angiopoietin-1 Antibody (6C4S7) [NBP3-16269] - Immunohistochemistry of paraffin-embedded human colon using Angiopoietin-1 Rabbit mAb (NBP3-16269) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Applications for Angiopoietin-1 Antibody (6C4S7)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Angiopoietin-1

Angiopoeitin-1 (Ang-1) and Antiopoietin-2 (Ang2) are important for development of the endothelium, by regulating tyrosine phosphorylation of the membrane receptor Tie-2/Tek. Ang-1 binding to Tie-2/Tek causes phosphorylation of the receptor. Ang-2 competes for this binding, and thus blocks receptor phosphorylation. Ang-1 has potential fibrinogen-like domain at the carboxy terminus and coiled-coil regions in the amino terminus. Ang-1 is prominently expressed in the myocardium of atrium and ventricle, mesenchymal and smooth muscle cells surrounding most blood vessels, and lung. In the adult, ANG-1 is also expressed in the heart and liver.To our knowledge, this is the first time that an Ang antibody recognises a band above 55 kD. This antibody gives a band at 75 kD which resembles the original size, because these are soluble highly glycosylated proteins, which should run higher than the calculated molecular weight of 55 kD.

Alternate Names

ANGPT1

Gene Symbol

ANGPT1

Additional Angiopoietin-1 Products

Product Documents for Angiopoietin-1 Antibody (6C4S7)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Angiopoietin-1 Antibody (6C4S7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.