Aquaporin 1/AQP1 Antibody (8V1O3)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16354

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16354-100ul
NBP3-16354-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 8V1O3

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Aquaporin 1/AQP1 Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 170-269 of human Aquaporin-1 (Aquaporin 1/AQP1) (P29972). LAIGLSVALGHLLAIDYTGCGINPARSFGSAVITHNFSNHWIFWVGPFIGGALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Aquaporin 1/AQP1 Antibody (8V1O3)

Western Blot: Aquaporin 1/AQP1 Antibody (8V1O3) [NBP3-16354]

Western Blot: Aquaporin 1/AQP1 Antibody (8V1O3) [NBP3-16354]

Western Blot: Aquaporin 1/AQP1 Antibody (8V1O3) [NBP3-16354] - Western blot analysis of extracts of Mouse liver, using Aquaporin-1 (Aquaporin 1/AQP1) Rabbit mAb (NBP3-16354) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Western Blot: Aquaporin 1/AQP1 Antibody (8V1O3) [NBP3-16354]

Western Blot: Aquaporin 1/AQP1 Antibody (8V1O3) [NBP3-16354]

Western Blot: Aquaporin 1/AQP1 Antibody (8V1O3) [NBP3-16354] - Western blot analysis of extracts of various cell lines, using Aquaporin-1 (Aquaporin 1/AQP1) Rabbit mAb (NBP3-16354) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Aquaporin 1/AQP1 Antibody (8V1O3)

Immunohistochemistry-Paraffin: Aquaporin 1/AQP1 Antibody (8V1O3) [NBP3-16354] -

Immunohistochemistry-Paraffin: Aquaporin 1/AQP1 Antibody (8V1O3) [NBP3-16354] -Analysis of Aquaporin-1 (AQP1) in paraffin-embedded human breast cancer using Aquaporin-1 (AQP1) Rabbit mAb at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
View 2 more images

Applications for Aquaporin 1/AQP1 Antibody (8V1O3)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Aquaporin 1/AQP1

Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein (MIP or AQP0). Thisgene encodes an aquaporin which functions as a molecular water channel protein. It is a homotetramer with 6 bilayerspanning domains and N-glycosylation sites. The protein physically resembles channel proteins and is abundant inerythrocytes and renal tubes. The gene encoding this aquaporin is a possible candidate for disorders involvingimbalance in ocular fluid movement. (provided by RefSeq)

Alternate Names

AQP1, CHIP28, CO

Gene Symbol

AQP1

Additional Aquaporin 1/AQP1 Products

Product Documents for Aquaporin 1/AQP1 Antibody (8V1O3)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Aquaporin 1/AQP1 Antibody (8V1O3)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.