ATP5O Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-32602

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-32602
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all ATP5O Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: LEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ATP5O Antibody

Western Blot: ATP5O Antibody [NBP2-32602]

Western Blot: ATP5O Antibody [NBP2-32602]

Western Blot: ATP5O Antibody [NBP2-32602] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunohistochemistry-Paraffin: ATP5O Antibody [NBP2-32602]

Immunohistochemistry-Paraffin: ATP5O Antibody [NBP2-32602]

Immunohistochemistry-Paraffin: ATP5O Antibody [NBP2-32602] - Staining in human kidney and pancreas tissues using anti-ATP5O antibody. Corresponding ATP5O RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ATP5O Antibody [NBP2-32602]

Immunohistochemistry-Paraffin: ATP5O Antibody [NBP2-32602]

Immunohistochemistry-Paraffin: ATP5O Antibody [NBP2-32602] - Staining of human kidney shows high expression.
View 1 more images

Applications for ATP5O Antibody

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ATP5O

ATP5O is a 213 amino acid F-type ATPase protein that is involved in producing ATP from ADP in the mitochondrial membrane when a proton gradient has been established across the membrane through the movement of charges across an electron transport complex in the respiratory chain. Current research is being performed on several diseases and disorders including graves disease, hashimotos thyroiditis, hypothyroidism, autoimmunity, goiter, diabetes mellitus, Huntington's disease, stomach cancer, osteoporosis, Parkinsons, twinning, osteosarcoma, hepatitis, and malaria. This protein has also been shown to have interactions with ATP5A1, ATP5B, ATP5D, IKBKG, and MPG in pathways such as the oxidative phosphorylation, metabolic, citric acid cycle (TCA), and Alzheimer's pathways.

Alternate Names

ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit, human ATP synthase OSCP subunit, oligomycin sensitivity conferring protein10ATPOATP synthase subunit O, mitochondrial, Oligomycin sensitivity conferral protein, oligomycin sensitivity conferring protein, OSCPhuman ATP synthase OSCP subunit

Gene Symbol

ATP5PO

Additional ATP5O Products

Product Documents for ATP5O Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for ATP5O Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.