Skip to main content

ATP6V1G2 Antibody (2E11) - Azide and BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # H00000534-M02

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
H00000534-M02

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2b Lambda Clone # 2E11

Format

Azide and BSA Free

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

ATP6V1G2 (NP_569730, 41 a.a. ~ 118 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QMEVEQYRREREHEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYRISA

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Specificity

ATP6V1G2 - ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G2

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2b Lambda

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for ATP6V1G2 Antibody (2E11) - Azide and BSA Free

Western Blot: ATP6V1G2 Antibody (2E11) [H00000534-M02]

Western Blot: ATP6V1G2 Antibody (2E11) [H00000534-M02]

Western Blot: ATP6V1G2 Antibody (2E11) [H00000534-M02] - Analysis of ATP6V1G2 expression in transfected 293T cell line by ATP6V1G2 monoclonal antibody (M02), clone 2E11.Lane 1: ATP6V1G2 transfected lysate(13.6 KDa).Lane 2: Non-transfected lysate.
Western Blot: ATP6V1G2 Antibody (2E11) [H00000534-M02]

Western Blot: ATP6V1G2 Antibody (2E11) [H00000534-M02]

Western Blot: ATP6V1G2 Antibody (2E11) [H00000534-M02] - ATP6V1G2 monoclonal antibody (M02), clone 2E11. Analysis of ATP6V1G2 expression in PC-12.
Western Blot: ATP6V1G2 Antibody (2E11) [H00000534-M02]

Western Blot: ATP6V1G2 Antibody (2E11) [H00000534-M02]

Western Blot: ATP6V1G2 Antibody (2E11) [H00000534-M02] - ATP6V1G2 monoclonal antibody (M02), clone 2E11 Analysis of ATP6V1G2 expression in HepG2.

Applications for ATP6V1G2 Antibody (2E11) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: ATP6V1G2

This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is one of three V1 domain G subunit proteins. This gene had previous gene symbols of ATP6G and ATP6G2. Alternatively spliced transcript variants encoding different isoforms have been described.

Alternate Names

ATP6G2, ATPase, H+ transporting, lysosomal (vacuolar proton pump), ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G isoform 2, ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G2, Em:AC004181.3, subunit G2, vacuolar ATP synthase subunit G 2, vacuolar proton pump G subunit 2, Vacuolar proton pump subunit G 2, V-ATPase 13 kDa subunit 2, V-ATPase subunit G 2, Vma10, V-type proton ATPase subunit G 2

Entrez Gene IDs

534 (Human)

Gene Symbol

ATP6V1G2

OMIM

606853 (Human)

Additional ATP6V1G2 Products

Product Documents for ATP6V1G2 Antibody (2E11) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ATP6V1G2 Antibody (2E11) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...