Bcl3 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-87068

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-87068
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all Bcl3 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human Bcl3. Peptide sequence: MVARSRRVIDILRGKATRPASTSQPDPSPDRSANTSPESSSRLSSNGLLS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Bcl3 Antibody

Western Blot: Bcl3 Antibody [NBP2-87068]

Western Blot: Bcl3 Antibody [NBP2-87068]

Western Blot: Bcl3 Antibody [NBP2-87068] - Host: Rabbit. Target Name: BCL3. Sample Tissue: Human OVCAR-3 Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for Bcl3 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Bcl3

The transcriptional coactivator, B-cell lymphoma 3-encoded protein (Bcl3) is a member of the inhibitor of nuclear factor kappaB (NF-kappaB) family. Also a known regulator of NF-kappaB, Bcl-3 plays a critical role in the development of normal immune responses. Specifically, Bcl 3 regulates transcriptional activation of NF-kappa-B target genes, by inhibiting the nuclear translocation of the NF-kappa-B p50 subunit in the cytoplasm and acting as transcriptional activator that promotes transcription of NF-kappa-B target genes in the nucleus.

Bcl-3 also contributes to the regulation of cell proliferation, and influences the survival of T cells when they are activated as a result of an immune response. It also contributes to chronic inflammatory disease states such as osteoarthritis and rheumatoid arthritis, and defects in Bcl3 may lead to B-cell chronic lymphocytic leukemia. Therefore, Bcl3 antibodies can be useful tools for studying autoimmune disease and cancer development.

Alternate Names

B-cell CLL/lymphoma 3, B-cell leukemia/lymphoma 3, B-cell lymphoma 3 protein, B-cell lymphoma 3-encoded protein, BCL-3, BCL4, chronic lymphatic leukemia protein, D19S37, Proto-oncogene BCL3

Gene Symbol

BCL3

Additional Bcl3 Products

Product Documents for Bcl3 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Bcl3 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.