BNIP3L Antibody - Azide and BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-92792

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-92792-0.02ml
NBP2-92792-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all BNIP3L Antibodies »

Product Summary for BNIP3L Antibody - Azide and BSA Free

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 95-180 of human BNIP3L (NP_004322.1). SPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVSDWSSRPENIPPKEFHFRHPKRSVSLSMRKSGAMKKGGI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for BNIP3L Antibody - Azide and BSA Free

Western Blot: BNIP3L AntibodyAzide and BSA Free [NBP2-92792]

Western Blot: BNIP3L AntibodyAzide and BSA Free [NBP2-92792]

Western Blot: BNIP3L Antibody [NBP2-92792] - Western blot analysis of extracts of various cell lines, using BNIP3L antibody (NBP2-92792) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
Immunocytochemistry/ Immunofluorescence: BNIP3L Antibody - Azide and BSA Free [NBP2-92792]

Immunocytochemistry/ Immunofluorescence: BNIP3L Antibody - Azide and BSA Free [NBP2-92792]

Immunocytochemistry/Immunofluorescence: BNIP3L Antibody [NBP2-92792] - Immunofluorescence analysis of NIH/3T3 cells using BNIP3L Rabbit pAb (NBP2-92792) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: BNIP3L Antibody - Azide and BSA Free [NBP2-92792]

Immunohistochemistry-Paraffin: BNIP3L Antibody - Azide and BSA Free [NBP2-92792]

Immunohistochemistry-Paraffin: BNIP3L Antibody [NBP2-92792] - Immunohistochemistry of paraffin-embedded rat kidney using BNIP3L Rabbit pAb (NBP2-92792) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
View 1 more images

Applications for BNIP3L Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.09% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: BNIP3L

Members in the Bcl-2 family are critical regulators of apoptosis by either inhibiting or promoting cell death. Bcl-2 homology 3 (BH3) domain is a potent death domain. BH3 domain containing pro-apoptotic proteins, including Bad, Bax, Bid, Bik, Hrk, Nip3, and Bim, form a growingsubclass of the Bcl-2 family. A novel BH3 domaincontaining protein was recently identified and designated Bnip3L, Bnip3a, and Nix (for Nip3-like protein X) (Matsushima, M. et al.; Yasuda, M. et al.; Chen, G, et al.).Bnip3L/Bnip3a/Nix is a homolog of the E1B 19K/Bcl-2 binding and pro-apoptotic protein Bnip3. Over expression of Bnip3L induces apoptosis (Yasuda, M. et al.; Chen, G, et al.). Bnip3L interacts withand overcomes suppresses by Bcl-2 and Bcl-xL. Bnip3Lis localized in mitochondria. The messenger RNA of Bnip3L is ubiquitously expressed in human tissues (Matsushima, M. et al.; Yasuda, M. et al.). Bnip3L and Bnip3 form a new subfamily of the pro-apoptotic mitochondrial proteins.

Long Name

BCL2/Adenovirus E1B 19 Kda Protein-Interacting Protein 3-Like

Alternate Names

BNIP3a, Nip3L, Nix

Gene Symbol

BNIP3L

Additional BNIP3L Products

Product Documents for BNIP3L Antibody - Azide and BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for BNIP3L Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.