c-Myc Antibody - BSA Free
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-56660
Key Product Details
Species Reactivity
Human
Applications
Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Product Specifications
Immunogen
This antibody was developed against a c-Myc Antibody recombinant protein corresponding to the following amino acid sequence: QAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSP
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
67 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for c-Myc Antibody - BSA Free
![Immunocytochemistry/ Immunofluorescence: c-Myc Antibody [NBP2-56660]](https://resources.bio-techne.com/images/products/c-Myc-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-56660-img0001.jpg "Immunocytochemistry/ Immunofluorescence: c-Myc Antibody [NBP2-56660]")
Immunocytochemistry/ Immunofluorescence: c-Myc Antibody [NBP2-56660]
Immunocytochemistry/Immunofluorescence: c-Myc Antibody [NBP2-56660] - Staining of human cell line SK-MEL-30 shows localization to nucleoplasm.Applications for c-Myc Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: c-Myc
A basic Helix-Loop-Helix, Leucine Zipper domain (bHLH/LZ), designated Max, specifically associates with c-Myc, N-Myc and L-Myc proteins. The Myc-Max complex binds to DNA in a sequence-specific manner under conditions where neither Max nor Myc exhibit appreciable binding. Max can also form heterodimers with other bHLH-Zip proteins, Mad and Mxi1. c-Myc plays a role in cell cycle progression, apoptosis, cellular transformation and angiogenesis (2). Mutations, overexpression, rearrangement and translocation of this gene have been associated with a variety of cancers including B-cell Lymphomas, acute myeloid leukemia, glioblastoma, stomach adenocarcinoma, and prostate adenocarcinoma (3).
References
1. Wilkinson, D. S., Tsai, W. W., Schumacher, M. A., & Barton, M. C. (2008). Chromatin-bound p53 anchors activated Smads and the mSin3A corepressor to confer transforming-growth-factor-beta-mediated transcription repression. Mol Cell Biol, 28(6), 1988-1998. doi:10.1128/mcb.01442-07
2. Pedrosa, A. R., Bodrug, N., Gomez-Escudero, J., Carter, E. P., Reynolds, L. E., Georgiou, P. N., . . . Hodivala-Dilke, K. M. (2019). Tumor Angiogenesis Is Differentially Regulated by Phosphorylation of Endothelial Cell Focal Adhesion Kinase Tyrosines-397 and -861. Cancer Res, 79(17), 4371-4386. doi:10.1158/0008-5472.Can-18-3934
3. Nagasaka, M., Tsuzuki, K., Ozeki, Y., Tokugawa, M., Ohoka, N., Inoue, Y., & Hayashi, H. (2019). Lysine-Specific Demethylase 1 (LSD1/KDM1A) Is a Novel Target Gene of c-Myc. Biol Pharm Bull, 42(3), 481-488. doi:10.1248/bpb.b18-00892
Long Name
v-Myc Avian Myelocytomatosis Viral Oncogene Homolog (Avian)
Alternate Names
cMyc, Myc, Myc2, Niard, Nird
Gene Symbol
MYC
Additional c-Myc Products
Product Documents for c-Myc Antibody - BSA Free
Product Specific Notices for c-Myc Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...