CCT6B Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-56939

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-56939
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all CCT6B Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to CCT6B(chaperonin containing TCP1, subunit 6B (zeta 2)) The peptide sequence was selected from the N terminal of CCT6B. Peptide sequence VARTSLQTKVHAELADVLTEVVVDSVLAVRRPGYPIDLFMVEIMEMKHKL. The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: zeta-2.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CCT6B Antibody

Western Blot: CCT6B Antibody [NBP1-56939]

Western Blot: CCT6B Antibody [NBP1-56939]

Western Blot: CCT6B Antibody [NBP1-56939] - 293T cells lysate, Antibody Titration: 0.2-1 ug/ml
Western Blot: CCT6B Antibody [NBP1-56939]

Western Blot: CCT6B Antibody [NBP1-56939]

Western Blot: CCT6B Antibody [NBP1-56939] - 293T cells lysate, Antibody Titration: 1 ug/ml

Applications for CCT6B Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CCT6B

CCT6B is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin.This gene encodes a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized.

Alternate Names

CCTZ2, CCTZ-2, CCT-zeta-2, CCT-zeta-like, chaperonin containing TCP1, subunit 6B (zeta 2), T-complex protein 1 subunit zeta-2, T-complex protein 1, zeta-2 subunit, TCP-1-zeta-2, TCP-1-zeta-like, Testis-specific protein TSA303, Testis-specific Tcp20, TSA303

Gene Symbol

CCT6B

Additional CCT6B Products

Product Documents for CCT6B Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for CCT6B Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.