COBRA1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-82924

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-82924
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all COBRA1 Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KETLTNCTEPLKAIEQFQTENGVLLPSLQSALPFLDLHGTPRLEFHQSVFDELRDKLLERVSAIASEGKAEERYKKLED

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for COBRA1 Antibody

Immunohistochemistry-Paraffin: COBRA1 Antibody [NBP1-82924]

Immunohistochemistry-Paraffin: COBRA1 Antibody [NBP1-82924]

Immunohistochemistry-Paraffin: COBRA1 Antibody [NBP1-82924] - Analysis in human skin and liver tissues. Corresponding NELFB RNA-seq data are presented for the same tissues.
Western Blot: COBRA1 Antibody [NBP1-82924]

Western Blot: COBRA1 Antibody [NBP1-82924]

Western Blot: COBRA1 Antibody [NBP1-82924] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: COBRA1 Antibody [NBP1-82924]

Immunocytochemistry/ Immunofluorescence: COBRA1 Antibody [NBP1-82924]

Immunocytochemistry/Immunofluorescence: COBRA1 Antibody [NBP1-82924] - Saining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
View 5 more images

Applications for COBRA1 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reviewed Applications

Read 1 review rated 4 using NBP1-82924 in the following applications:

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: COBRA1

NELFB is a subunit of negative elongation factor (NELF), which also includes NELFA (WHSC2; MIM 606026), either NELFC or NELFD (TH1L; MIM 605297), and NELFE (RDBP; MIM 154040). NELF acts with DRB sensitivity-inducing factor (DSIF), a heterodimer of SPT4 (SUPT4H1; MIM 603555) and SPT5 (SUPT5H; MIM 602102), to cause transcriptional pausing of RNA polymerase II (see MIM 180660) (Narita et al., 2003 [PubMed 12612062]).[supplied by OMIM]

Alternate Names

cofactor of BRCA1DKFZp586B0519, KIAA1182negative elongation factor B, NELFB, NELF-Bnegative elongation factor protein B

Gene Symbol

COBRA1

Additional COBRA1 Products

Product Documents for COBRA1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for COBRA1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.