Collagen I alpha 1 Antibody
Novus Biologicals, part of Bio-Techne | Catalog # NBP1-82488
Key Product Details
Species Reactivity
Human
Applications
Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Product Specifications
Immunogen
This Collagen I alpha 1 antibody was developed against Recombinant Protein corresponding to amino acids: DRDVWKPEPCRICVCDNGKVLCDDVICDETKNCPGAEVPEGECCPVCPDGSESPTDQETTGVEGPKGDTGPRGPRGPAGPPGRDGIPGQPGLPGP
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
139 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for Collagen I alpha 1 Antibody
Immunocytochemistry/ Immunofluorescence: Collagen I alpha 1 Antibody [NBP1-82488]
Immunocytochemistry/Immunofluorescence: Collagen I alpha 1 Antibody [NBP1-82488] - Staining of human cell line U-2 OS shows localization to cytosol & vesicles. Antibody staining is shown in green.Immunohistochemistry-Paraffin: Collagen I alpha 1 Antibody [NBP1-82488]
Immunohistochemistry-Paraffin: Collagen I alpha 1 Antibody [NBP1-82488] - Staining of human colorectal cancer shows strong strong cytoplasmic positivity in tumor cells.Immunohistochemistry-Paraffin: Collagen I alpha 1 Antibody [NBP1-82488]
Immunohistochemistry-Paraffin: Collagen I alpha 1 Antibody [NBP1-82488] - Staining of human cervix shows moderate cytoplasmic positivity in squamous epithelial cells.Applications for Collagen I alpha 1 Antibody
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Immunogen affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Collagen I alpha 1
Type I collagen is a fibril-forming collagen found in most connective tissues and is abundant in bone, cornea, dermis and tendon tissue. Collagens are fibrous, extracellular matrix proteins with high tensile strength and are the major components of connective tissue. Several collagens play a role in cell adhesion, responsible for maintaining normal tissue architecture and function. All collagens contain a triple helix domain and frequently show lateral self-association in order to form complex connective tissues. Post-Golgi LH3 trafficking is essential for collagen homeostasis and for the development and function of multiple organs and tissues (1).
The COL1A1 gene encodes the pro-alpha1 chains of type I collagen protein, whose triple helix is comprised of two alpha1 chains and one alpha2 chain. Mutations in the encoding COL1A1 gene are associated with brittle bone disease (Osteogenesis Imperfecta), cortical hyperostosis (Caffey disease) and disorders that affect the connective tissues (Ehlers-Danlos syndrome) (2). Studies have found that HIF-1 transcription regulation of collagen prolyl hydroxylases regulates collagen deposition, promoting cancer cell alignment along collagen fibers, which enhances invasion and metastasis to lymph nodes and lung tissue by breast cancer cells (3).
References
1. Banushi, B., Forneris, F., Straatman-Iwanowska, A., Strange, A., Lyne, A. M., Rogerson, C., . . . Gissen, P. (2016). Regulation of post-Golgi LH3 trafficking is essential for collagen homeostasis. Nat Commun, 7, 12111. doi:10.1038/ncomms12111
2. Lu, Y., Zhang, S., Wang, Y., Ren, X., & Han, J. (2019). Molecular mechanisms and clinical manifestations of rare genetic disorders associated with type I collagen. Intractable Rare Dis Res, 8(2), 98-107. doi:10.5582/irdr.2019.01064
3. Gilkes, D. M., Chaturvedi, P., Bajpai, S., Wong, C. C., Wei, H., Pitcairn, S., . . . Semenza, G. L. (2013). Collagen prolyl hydroxylases are essential for breast cancer metastasis. Cancer Res, 73(11), 3285-3296. doi:10.1158/0008-5472.Can-12-3963
Additional Collagen I alpha 1 Products
Product Documents for Collagen I alpha 1 Antibody
Product Specific Notices for Collagen I alpha 1 Antibody
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...
Loading...