Coronin-1a Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-38604

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-38604-100ul
NBP3-38604-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Coronin-1a Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 362-461 of human Coronin-1a (NP_001180262.1).

Sequence:
DLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Coronin-1a Antibody

Coronin-1a Antibody

Immunohistochemistry: Coronin-1a Antibody [NBP3-38604] -

Immunohistochemistry: Coronin-1a Antibody [NBP3-38604] - Immunohistochemistry analysis of paraffin-embedded Mouse spleen using Coronin-1a Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Coronin-1a Antibody

Immunohistochemistry: Coronin-1a Antibody [NBP3-38604] -

Immunohistochemistry: Coronin-1a Antibody [NBP3-38604] - Immunohistochemistry analysis of paraffin-embedded Human esophageal cancer using Coronin-1a Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Coronin-1a Antibody

Western Blot: Coronin-1a Antibody [NBP3-38604] -

Western Blot: Coronin-1a Antibody [NBP3-38604] - Western blot analysis of various lysates using Coronin-1a Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
View 3 more images

Applications for Coronin-1a Antibody

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Coronin-1a

Coronin was originally discovered in Dictyostelium, where it was found to be involved in the chemotactic response of these ameboid cells. The name derives from the fact that the protein is localized at the leading edge or crown of these highly motile cells. The name derives from Corona, which is latin for crown. Coronin homologues have been found in yeast, C. elegans, Drosophila and many other species, and a family them are known in mammals. All coronins belong to the WD40 or WD family of proteins, the prototype or which is the beta subunit of trimeric G-proteins. Coronins appear to be particularly involved in binding to actin, actin associated proteins, tubulin and phospholipase C and have been implicated in the mechanisms of chemotaxis and phagocytosis. In mammals there are at least five major coronin proteins, named coronins 1 to 5 in one nomenclature. Another nomenclature divides these five proteins in coronins 1a and 1b, 2a, 2b and 2c. The mammalian coronin family members are abundant components of eukaryotic cells, and each type has a restricted cell type specific expression pattern. Coronin 1A is the mammalian coronin most similar in protein sequence to the Dictyostelium protein and is found exclusively in hematopoetic lineage cells such as lymphocytes, macrophages and neutrophils. NB 110-58867 is therefore an excellent marker of cells of this lineage and can also be used to study the leading edges particularly of neutrophils. Since the only hematopoetic cells found within the central nervous system are microglia, this antibody is also an excellent marker of this important cell type. Microglia are numerically fairly minor components of the nervous system, but microglial activation is seen in response to a wide variety of damage and disease states, including ALS, Alzheimer's disease and responses to brain tumors. Since coronin 1a is a constitutive component of microglia, the coronin 1a antibody can be used to study both quiescent and activated microglia.

Alternate Names

CLIPINA, Clipin-A, CORO1, coronin, actin binding protein, 1A, coronin, actin-binding protein, 1A, coronin-1, coronin-1A, Coronin-like protein A, Coronin-like protein p57, FLJ41407, HCORO1, MGC117380, p57, TACOCLABP, Tryptophan aspartate-containing coat protein

Gene Symbol

CORO1A

Additional Coronin-1a Products

Product Documents for Coronin-1a Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Coronin-1a Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.