CSDE1 Antibody [DyLight 405]

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-38216V

Novus Biologicals, part of Bio-Techne

Key Product Details

Species Reactivity

Human, Mouse

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Western Blot

Label

DyLight 405 (Excitation = 400 nm, Emission = 420 nm)

Antibody Source

Polyclonal Rabbit IgG

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all CSDE1 Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 369-600 of human CSDE1 (NP_009089.4).

Sequence:
LSAQRNHAIRIKKLPKGTVSFHSHSDHRFLGTVEKEATFSNPKTTSPNKGKEKEAEDGIIAYDDCGVKLTIAFQAKDVEGSTSPQIGDKVEFSISDKQRPGQQVATCVRLLGRNSNSKRLLGYVATLKDNFGFIETANHDKEIFFHYSEFSGDVDSLELGDMVEYSLSKGKGNKVSAEKVNKTHSVNGITEEADPTIYSGKVIRPLRSVDPTQTEYQGMIEIVEEGDMKGEV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Applications for CSDE1 Antibody [DyLight 405]

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Immunoprecipitation

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

50mM Sodium Borate

Preservative

0.05% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: CSDE1

CSDE1, also known as Cold shock domain-containing protein E1, is a 798 amino acid long isoform that is 89 kDa and a short 767 amino acid isoform that is approx. 86 kDa, which is directly related to the translation of the human rhinovirus RNA as an RNA binding protein. Studies are being performed on the relationship of this protein to chronic lymphocytic leukemia, diamond-blackfan anemia, lymphocytic leukemia, breast cancer, and shock. CSDE1 protein involvement has been observed with relation to PCSK7, SYNCRIP, PABPC1, HNRNPD, PIK3R1 in the regulation of transcription DNA-dependent and male gonad development pathways.

Alternate Names

cold shock domain containing E1, RNA-binding, cold shock domain-containing protein E1, D1S155EUNRRP5-1000E10.3, DKFZp779B0247, DKFZp779J1455, FLJ26882, KIAA0885, N-ras upstream gene protein, NRAS-related, NRU, Protein UNR, upstream of NRAS

Gene Symbol

CSDE1

Additional CSDE1 Products

Product Documents for CSDE1 Antibody [DyLight 405]

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for CSDE1 Antibody [DyLight 405]



DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.