CTP synthase Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-52892

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-52892
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

1 mg/ml

View all CTP Synthase/CTPS1 Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to CTPS(CTP synthase) The peptide sequence was selected from the N terminal of CTPS. Peptide sequence SMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

67 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CTP synthase Antibody

Western Blot: CTP synthase Antibody [NBP1-52892]

Western Blot: CTP synthase Antibody [NBP1-52892]

Western Blot: CTP synthase Antibody [NBP1-52892] - Lanes: 1 : 45ug human capan1 cell lysate Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-rabbit HRP Secondary, Antibody Dilution: 1 : 5000 Gene name: CTPS.
Immunohistochemistry-Paraffin: CTP synthase Antibody [NBP1-52892]

Immunohistochemistry-Paraffin: CTP synthase Antibody [NBP1-52892]

Immunohistochemistry-Paraffin: CTP synthase Antibody [NBP1-52892] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.
Western Blot: CTP synthase Antibody [NBP1-52892]

Western Blot: CTP synthase Antibody [NBP1-52892]

Western Blot: CTP synthase Antibody [NBP1-52892] - 721B tissue lysate at a concentration of 5ug/ml.

Applications for CTP synthase Antibody

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Reviewed Applications

Read 1 review rated 3 using NBP1-52892 in the following applications:

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CTP Synthase/CTPS1

The catalytic conversion of UTP to CTP is accomplished by the enzyme cytidine-5-prime-triphosphate synthetase. The enzyme is important in the biosynthesis of phospholipids and nucleic acids, and plays a key role in cell growth, development, and tumorigenesis.The catalytic conversion of UTP to CTP is accomplished by the enzyme cytidine-5-prime-triphosphate synthetase. The enzyme is important in the biosynthesis of phospholipids and nucleic acids, and plays a key role in cell growth, development, and tumorigenesis. The region to which the CTPS gene has been mapped is the location of breakpoints involved in several tumor types.The catalytic conversion of UTP to CTP is accomplished by the enzyme cytidine-5-prime-triphosphate synthetase. The enzyme is important in the biosynthesis of phospholipids and nucleic acids, and plays a key role in cell growth, development, and tumorigenesis. The region to which the CTPS gene has been mapped is the location of breakpoints involved in several tumor types.

Long Name

Cytidine 5'-Triphosphate Synthetase

Alternate Names

CTP Synthase 1, GATD5, IMD24

Gene Symbol

CTPS1

UniProt

P17812 (Human)

Additional CTP Synthase/CTPS1 Products

Product Documents for CTP synthase Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for CTP synthase Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.