Cytochrome C Oxidase subunit 6c Antibody (S51)

Novus Biologicals, part of Bio-Techne | Catalog # H00001345-M03

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
H00001345-M03
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # S51

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all Cytochrome C Oxidase subunit 6c Antibodies »

Product Specifications

Immunogen

COX6C (AAH00187, 1 a.a. ~ 75 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK

Specificity

COX6C - cytochrome c oxidase subunit VIc

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for Cytochrome C Oxidase subunit 6c Antibody (S51)

Immunohistochemistry-Paraffin: Cytochrome C Oxidase subunit 6c Antibody (S51) [H00001345-M03]

Immunohistochemistry-Paraffin: Cytochrome C Oxidase subunit 6c Antibody (S51) [H00001345-M03]

Immunohistochemistry-Paraffin: Cytochrome C Oxidase subunit 6c Antibody (S51) [H00001345-M03] - Analysis of monoclonal antibody to COX6C on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 1 ug/ml
ELISA: Cytochrome C Oxidase subunit 6c Antibody (S51) [H00001345-M03]

ELISA: Cytochrome C Oxidase subunit 6c Antibody (S51) [H00001345-M03]

ELISA: Cytochrome C Oxidase subunit 6c Antibody (S51) [H00001345-M03] - Detection limit for recombinant GST tagged COX6C is approximately 1ng/ml as a capture antibody.

Applications for Cytochrome C Oxidase subunit 6c Antibody (S51)

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Cytochrome C Oxidase subunit 6c

Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIc, which has 77% amino acid sequence identity with mouse COX subunit VIc. This gene is up-regulated in prostate cancer cells. A pseudogene COX6CP1 has been found on chromosomes 16p12.

Alternate Names

Cytochrome c oxidase polypeptide VIc, cytochrome c oxidase subunit 6C, cytochrome c oxidase subunit VIc, cytochrome c oxidase subunit VIc preprotein

Entrez Gene IDs

1345 (Human)

Gene Symbol

COX6C

OMIM

124090 (Human)

UniProt

AAH00187 (Human)

Additional Cytochrome C Oxidase subunit 6c Products

Product Documents for Cytochrome C Oxidase subunit 6c Antibody (S51)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Cytochrome C Oxidase subunit 6c Antibody (S51)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.