DDX21 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-38311

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-38311
NBP2-38311-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all DDX21 Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: DSRRWQLSVATEQPELEGPREGYGGFRGQREGSRGFRGQRDGNRRFRGQREGSRGPRGQRSGGGNKSNRSQNKGQKRSFSKAFGQ

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (82%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DDX21 Antibody

Western Blot: DDX21 Antibody [NBP2-38311]

Western Blot: DDX21 Antibody [NBP2-38311]

Western Blot: DDX21 Antibody [NBP2-38311] - Analysis using Anti-DDX21 antibody NBP2-38311 (A) shows similar pattern to independent antibody NBP1-83310 (B).
Immunocytochemistry/ Immunofluorescence: DDX21 Antibody [NBP2-38311]

Immunocytochemistry/ Immunofluorescence: DDX21 Antibody [NBP2-38311]

Immunocytochemistry/Immunofluorescence: DDX21 Antibody [NBP2-38311] - Staining of human cell line U-2 OS shows localization to nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DDX21 Antibody [NBP2-38311]

Immunohistochemistry-Paraffin: DDX21 Antibody [NBP2-38311]

Immunohistochemistry-Paraffin: DDX21 Antibody [NBP2-38311] - Staining of human appendix shows strong positivity in nucleoli in lymphoid tissue.
View 6 more images

Applications for DDX21 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

1:100 - 1:250
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DDX21

DDX21 is a member of the DEAD box family of proteins that possesses several conserved motifs which include the highly conserved DEAD (Asp-Glu-Ala-Asp) amino acid sequence motif. The major activity of DEAD box proteins is to function as ATP-dependent RNA helicases. As helicases, DEAD proteins play an important role in all aspects of RNA metabolism and function which include pre-mRNA splicing, RNA synthesis, RNA degradation, RNA export, RNA translation, RNA secondary structure formation, ribosome biogenesis, and the assembly of RNP complexes. Some members of the DEAD box proteins also exhibit functions involved in transcriptional regulation. DDX21 has been shown to be required for the processing of 20S rRNA to 18S and has also been shown to be important for c-Jun transcriptional activation.

Alternate Names

DEAD (Asp-Glu-Ala-Asp) box polypeptide 21, DEAD box protein 21, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 21, DKFZp686F21172, EC 3.6.1, EC 3.6.4.13, Gu protein, GUA, gu-alpha, GURDB, nucleolar RNA helicase 2, Nucleolar RNA helicase Gu, Nucleolar RNA helicase II, RH II/Gu, RH-II/GU, RH-II/GuA, RNA helicase II/Gu alpha

Gene Symbol

DDX21

UniProt

Q9NR30 (Human)

Additional DDX21 Products

Product Documents for DDX21 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for DDX21 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.