DDX3 Antibody (2D7)

Novus Biologicals, part of Bio-Techne | Catalog # H00008653-M01

Submit a review

Product Datasheet / COA / SDS

Product Specifications
Scientific Data
Applications
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Species Reactivity

Human, Mouse

Applications

ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin, Sandwich ELISA, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG₁ kappa Clone # 2D7

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all DDX3 Antibodies »

Product Specifications

Immunogen

DDX3Y (NP_004651, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSHVVVKNDPELDQQLANLDLNSEKQSGGASTASKGRYIPPHLRNREASKGFHDKDSSGWSCSKDKDAYSSFGSRDSRGK

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Specificity

This antibody was raised to human DDX3Y fragment, however it is known to crossreact with DDX3X.

Clonality

Monoclonal

Host

Mouse

Isotype

IgG₁ kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for DDX3 Antibody (2D7)

Western Blot: DDX3 Antibody (2D7) [H00008653-M01]

Western Blot: DDX3 Antibody (2D7) [H00008653-M01] - DDX3Y monoclonal antibody (M01), clone 2D7. Analysis of DDX3Y expression in NIH/3T3.

Immunohistochemistry-Paraffin: DDX3 Antibody (2D7) [H00008653-M01]

Immunohistochemistry-Paraffin: DDX3 Antibody (2D7) [H00008653-M01] - Analysis of monoclonal antibody to DDX3Y on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.

Western Blot: DDX3 Antibody (2D7) [H00008653-M01]

Western Blot: DDX3 Antibody (2D7) [H00008653-M01] - DDX3Y monoclonal antibody (M01), clone 2D7. Analysis of DDX3Y expression in Raw 264.7.

View 2 more images

Applications for DDX3 Antibody (2D7)

Application

Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry-Paraffin

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.

Application Notes

Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.

Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: DDX3

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, and it has a homolog on the X chromosome. The gene mutation causes male infertility, Sertoli cell-only syndrome or severe hypospermatogenesis, suggesting that this gene plays a key role in the spermatogenic process. Alternatively spliced variants, encoding the same protein, have been identified.

Alternate Names

DBXCAP-Rf, DDX14, DDX3DEAD/H box-3, DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, X-linked, DEAD box protein 3, X-chromosomal, DEAD box, X isoform, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 3, EC 3.6.1, EC 3.6.4.13, helicase like protein 2, Helicase-like protein 2, HLP2ATP-dependent RNA helicase DDX3X

Entrez Gene IDs

8653 (Human)

Gene Symbol

DDX3X

OMIM

400010 (Human)

UniProt

NP_004651 (Human)

Additional DDX3 Products

Product Documents for DDX3 Antibody (2D7)

Product Datasheets

Download Product Datasheets

COA

SDS

Product Specific Notices for DDX3 Antibody (2D7)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations
Reviews