Skip to main content

DNA Polymerase gamma Antibody (9V9D9)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-15460

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-15460-100ul
NBP3-15460-20ul

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9V9D9

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1140-1239 of human DNA Polymerase gamma (P54098). LVREEDRYRAALALQITNLLTRCMFAYKLGLNDLPQSVAFFSAVDIDRCLRKEVTMDCKTPSNPTGMERRYGIPQGEALDIYQIIELTKGSLEKRSQPGP

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DNA Polymerase gamma Antibody (9V9D9)

Western Blot: DNA Polymerase gamma Antibody (9V9D9) [NBP3-15460]

Western Blot: DNA Polymerase gamma Antibody (9V9D9) [NBP3-15460]

Western Blot: DNA Polymerase gamma Antibody (9V9D9) [NBP3-15460] - Western blot analysis of extracts of various cell lines, using DNA Polymerase gamma Rabbit mAb (NBP3-15460) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Western Blot: DNA Polymerase gamma Antibody (9V9D9) [NBP3-15460]

Western Blot: DNA Polymerase gamma Antibody (9V9D9) [NBP3-15460]

Western Blot: DNA Polymerase gamma Antibody (9V9D9) [NBP3-15460] - Western blot analysis of extracts of various cell lines, using DNA Polymerase gamma Rabbit mAb (NBP3-15460) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Applications for DNA Polymerase gamma Antibody (9V9D9)

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: DNA Polymerase gamma

As the only DNA polymerase (pol) present in mitochondria, DNA polymerase gamma (POLG) is necessarily implicated in base excision repair processes to correct oxidative damage to the mitochondrial genome. Therefore, the ability of the catalytic subunit of human POLG has been tested to participate in uracil-provoked base excision repair reconstituted in vitro with purified components. Subsequent to actions of uracil-DNA glycosylase and apurinic/apyrimidinic endonuclease, human POLG is able to fill a single nucleotide gap in the presence of a 5' terminal deoxyribose phosphate (dRP) flap. The catalytic subunit of human pol gamma catalyzes release of the dRP residue from incised apurinic/apyrimidinic sites to produce a substrate for DNA ligase. Faulty replication of the human mitochondrial genome is thought to be the cause of many diseases. The low selectivity of the mitochondrial DNA polymerase is implicated as the cause of many side effects observed in the treatment of viral infections such as HIV.

Long Name

DNA polymerase subunit gamma-1

Alternate Names

MDP1, POLG, PolG-alpha, POLG1, POLGA

Gene Symbol

POLG

Additional DNA Polymerase gamma Products

Product Documents for DNA Polymerase gamma Antibody (9V9D9)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for DNA Polymerase gamma Antibody (9V9D9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...