DPP6 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-59925

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-59925
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all DPP6 Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to DPP6(dipeptidyl-peptidase 6) The peptide sequence was selected from the middle region of DPP6. Peptide sequence AAINDSRVPIMELPTYTGSIYPTVKPYHYPKAGSENPSISLHVIGLNGPT. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for DPP6 Antibody

Western Blot: DPP6 Antibody [NBP1-59925]

Western Blot: DPP6 Antibody [NBP1-59925]

Western Blot: DPP6 Antibody [NBP1-59925] - Lanes: Lane 1 : 20 ug HEK-293 cell lysate Lane 2: 20 ug hDPP6-YFP transfected HEK-293 lysate Lane 3: 20 ug hDPP10-YFP transfected HEK-293 lysate Primary Antibody Dilution: 1 : 1000 Secondary Antibody: Donkey anti-rabbit-HRP Secondary Antibody Dilution: 1 : 10,000 Gene name: DPP6 a Submitted by: Jeanne M. Nerbonne, Arvin Soepriatna, Washington University Medical School Department of Developmental Biology.
Western Blot: DPP6 Antibody [NBP1-59925]

Western Blot: DPP6 Antibody [NBP1-59925]

Western Blot: DPP6 Antibody [NBP1-59925] - Human Brain lysate, concentration 0.2-1 ug/ml.

Applications for DPP6 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DPP6

DPP6 is a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties.This gene encodes a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Long Name

Dipeptidyl-peptidase 6

Alternate Names

DPPX

Gene Symbol

DPP6

UniProt

P42658

Additional DPP6 Products

Product Documents for DPP6 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for DPP6 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.