EAAT3 Antibody [mFluor Violet 500 SE]

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-38021MFV500

Novus Biologicals, part of Bio-Techne

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Western Blot

Label

mFluor Violet 500 SE (Excitation = 410 nm, Emission = 501 nm)

Antibody Source

Polyclonal Rabbit IgG

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all EAAT3 Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 430-524 of human EAAT3 (NP_004161.4).

Sequence:
SIKPGVTQKVGEIARTGSTPEVSTVDAMLDLIRNMFPENLVQACFQQYKTKREEVKPPSDPEMNMTEESFTAVMTTAISKNKTKEYKIVG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Applications for EAAT3 Antibody [mFluor Violet 500 SE]

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

50mM Sodium Borate

Preservative

0.05% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: EAAT3

The EAAT3 gene encodes for glutamate transporters (also known as excitatory amino acid transporters, EAATs), that rapidly move glutamate from the postsynaptic cleft through the plasma membrane. The proteins are approximately 542 amino acids long at a mass barely over 57 kDA. This function allows for neurotoxic levels of glutamate in the brain to be avoided. It is common to see underactivity of glutamate receptors in some disorders such as ischemia and traumatic brain injuries and overactivity to be linked to mental illnesses such as schizophrenia. EAAT3 gene is also related to obsessive-compulsive disorder, ganglioglioma, autism spectrum disorders, aminoaciduriam temporal lobe epilepsy, hepatic encephalopathy, neuronitis, anorexia nervosa, and amyotrophic lateral sclerosis. It interacts with KNCN, HCCS, EWSR1, PRKCA, and ARL6IP5 to function in pathways of glutamic acid signaling, transmembrane transport of small molecules, and protein digestion and absorption.

Long Name

Excitatory amino acid transporter 3

Alternate Names

EAAC1, SLC1A1

Gene Symbol

SLC1A1

Additional EAAT3 Products

Product Documents for EAAT3 Antibody [mFluor Violet 500 SE]

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for EAAT3 Antibody [mFluor Violet 500 SE]

mFluor(TM) is a trademark of AAT Bioquest, Inc. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.