EDAR Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-69709

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-69709
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all EDAR Antibodies »

Product Summary for EDAR Antibody

Immunogen

Synthetic peptides corresponding to EDAR(ectodysplasin A receptor) The peptide sequence was selected from the middle region of EDAR. Peptide sequence PAPDKQGSPELCLLSLVHLAREKSATSNKSAGIQSRRKKILDVYANVCGV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for EDAR Antibody

Western Blot: EDAR Antibody [NBP1-69709]

Western Blot: EDAR Antibody [NBP1-69709]

Western Blot: EDAR Antibody [NBP1-69709] - Sample Type: Human Fetal Lung Antibody Dilution: 1.0 ug/ml
Western Blot: EDAR Antibody [NBP1-69709]

Western Blot: EDAR Antibody [NBP1-69709]

Western Blot: EDAR Antibody [NBP1-69709] - This Anti-EDAR antibody was used in Western Blot of Placenta tissue lysate at a concentration of 1ug/ml.
Western Blot: EDAR Antibody [NBP1-69709]

Western Blot: EDAR Antibody [NBP1-69709]

Western Blot: EDAR Antibody [NBP1-69709] - Sample Type: Human Fetal Muscle Antibody Dilution: 1.0 ug/ml

Applications for EDAR Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EDAR

EDAR is a member of the tumor necrosis factor receptor family. It is a receptor for the soluble ligand ectodysplasin A, and can activate the nuclear factor-kappaB, JNK, and caspase-independent cell death pathways. It is required for the development of hair, teeth, and other ectodermal derivatives. Mutations in the gene encoding EDAR result in autosomal dominant and recessive forms of hypohidrotic ectodermal dysplasia.This gene encodes a member of the tumor necrosis factor receptor family. The encoded transmembrane protein is a receptor for the soluble ligand ectodysplasin A, and can activate the nuclear factor-kappaB, JNK, and caspase-independent cell death pathways. It is required for the development of hair, teeth, and other ectodermal derivatives. Mutations in this gene result in autosomal dominant and recessive forms of hypohidrotic ectodermal dysplasia. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Long Name

Ectodysplasin Receptor

Alternate Names

Anhidrotic ectodysplasin receptor 1, DLED3, Ectodermal dysplasia receptor, ectodysplasin 1, anhidrotic receptor, ectodysplasin A receptor, Ectodysplasin-A receptor, ED1R, ED5, EDA1R, EDA3EDA-A1 receptor, EDA-A1R, Edar, FLJ94390, HRM1, mouse, homolog of, tumor necrosis factor receptor superfamily member EDAR

Gene Symbol

EDAR

UniProt

Q9UNE0

Additional EDAR Products

Product Documents for EDAR Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for EDAR Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.