ELA2A Antibody - Azide and BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-15533

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-15533-100ul
NBP3-15533-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all CELA2A Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 80-150 of human CELA2A (NP_254275.1). TYRVGLGRHNLYVAESGSLAVSVSKIVVHKDWNSNQISKGNDIALLKLANPVSLTDKIQLACLPPAGTILP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ELA2A Antibody - Azide and BSA Free

Western Blot: ELA2A AntibodyAzide and BSA Free [NBP3-15533]

Western Blot: ELA2A AntibodyAzide and BSA Free [NBP3-15533]

Western Blot: ELA2A Antibody [NBP3-15533] - Western blot analysis of extracts of Mouse lung, using ELA2A Rabbit pAb (NBP3-15533) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
Immunohistochemistry: ELA2A Antibody - Azide and BSA Free [NBP3-15533]

Immunohistochemistry: ELA2A Antibody - Azide and BSA Free [NBP3-15533]

Immunohistochemistry: ELA2A Antibody [NBP3-15533] - Immunofluorescence analysis of mouse pancreas using ELA2A antibody (NBP3-15533) at dilution of 1:100. Blue: DAPI for nuclear staining.

Applications for ELA2A Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 50% glycerol, pH7.3

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CELA2A

Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have sixelastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Like most of thehuman elastases, elastase 2A is secreted from the pancreas as a zymogen. In other species, elastase 2A has been shownto preferentially cleave proteins after leucine, methionine, and phenylalanine residues. (provided by RefSeq)

Long Name

Chymotrypsin Like Elastase 2A

Alternate Names

ELA2A, Elastase 2A

Gene Symbol

CELA2A

Additional CELA2A Products

Product Documents for ELA2A Antibody - Azide and BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for ELA2A Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.