Embigin/EMB Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-10832

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-10832-100ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all Embigin/EMB Antibodies »

Product Summary for Embigin/EMB Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of mouse Embigin/EMB (NP_034460.3). Peptide sequence LVAIILLCEVYTHKKKNDPDAGKEFEQIEQLKSDDSNGIENNVPRYRKTD

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Embigin/EMB Antibody

Western Blot: Embigin/EMB Antibody [NBP3-10832]

Western Blot: Embigin/EMB Antibody [NBP3-10832]

Western Blot: Embigin/EMB Antibody [NBP3-10832] - Western blot analysis of Embigin/EMB in Mouse Pancreas lysates. Antibody dilution at 1ug/ml

Applications for Embigin/EMB Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Embigin/EMB

Embigin (EMB) is a transmembrane glycoprotein belonging to the immunoglobulin superfamily (IgSF) proteins. It is a cell adhesion molecule that is preferentially expressed during mouse embryogenesis (1). Embigin, along with basigin and neuroplastin, form a small subgroup within the IgSF, with all members possessing a glutamate at the same position in the transmembrane domain (2). Mature, human Embigin is highly glycosylated and consists of an extracellular domain (ECD) wjth two Ig domains, a transmembrane region, and a short intracellular region. Within the ECD, human EMB shares 75% and 62% amino acid identity with mouse and rat EMB, respectively. Embigin is an accessory protein of monocarboxylic acid transporter, MCT2 which participates in transporting lactic acid between glial cells and neurons (3). Thus, it may be related to brain energy metabolism and has been investigated as a susceptible gene for schizophrenia (4). Embigin is highly expressed in early embryos of mice, and in the heart, lung, brain and other tissues of adult rats (5, 6). Loss of embigin promotes proliferation, anchorage-independent growth, and migration ability of breast cancer cells (7).

Alternate Names

EMB, GP70

Gene Symbol

EMB

Additional Embigin/EMB Products

Product Documents for Embigin/EMB Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Embigin/EMB Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.