Fc gamma RIII (CD16) Antibody - BSA Free
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-86597
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit
Format
BSA Free
Concentration
0.5 mg/ml
Product Specifications
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of CD16/CD32. Peptide sequence: DPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYF The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Scientific Data Images for Fc gamma RIII (CD16) Antibody - BSA Free
Fc gamma RIII (CD16) Antibody
WB Suggested Anti-Fc gamma RIII (CD16)Antibody. Titration: 1.0 ug/ml. Positive Control: Placenta
Fc gamma RIII (CD16) Antibody
Host: Rabbit. Target: Fc gamma RIII (CD16). Positive control (+): Mouse Spleen (M-SP). Negative control (-): Mouse Intestine (M-IN). Antibody concentration: 1ug/mlApplications for Fc gamma RIII (CD16) Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Fc gamma RIII (CD16)
Fc gamma RIIIA/CD16a is expressed as a transmembrane protein on NK cells and on a subset of monocytes, macrophages, CD4+T cells, basophils, and mast cells (1-3). Fc gamma RIIIB/CD16b is primarily expressed on neutrophils as a glycosylphosphatidylinositol (GPI)-anchored protein but is also expressed on a subset of basophils and can be induced on eosinophils (1-3). The soluble form of CD16 (sCD16) which is often produced following exposure to inflammatory signals and protein shedding via metalloproteinases (3). Reduced sCD16 levels have been found in patients with multiple myeloma (3).
Activating NK cell receptor function has been harnessed for its potential in tumor immunotherapy (6). One immunotherapy strategy is using bi- and tri-specific NK cell engagers (BiKE and TriKE) to target the Fc gamma RIIIA/CD16a receptor with tumor-associated antigens to stimulate a cytotoxic response and mount an attack on tumor cells (6). CD16a is also capable of antibody dependent cellular cytotoxicity (ADCC) through recognition of antibodies bound to target cells (6-7). CD16-induced NK cell activation allows for NK co-receptor expression including stimulatory receptors like CD137 or inhibitory receptors like TIGIT and PD-1, which serve as additional regulatory checkpoints during ADCC (7). Therapeutic antibodies for cancer treatment like rituximab or trastuzumab can be recognized by Fc gamma RIIIA/CD16a to activate NK cell-mediated killing of tumor cells (6-7).
References
1. Fossati, G., Bucknall, R. C., & Edwards, S. W. (2001). Fcgamma receptors in autoimmune diseases. European Journal of Clinical Investigation, 31(9), 821-831. https://doi.org/10.1046/j.1365-2362.2001.00881.x
2. Patel, K. R., Roberts, J. T., & Barb, A. W. (2019). Multiple Variables at the Leukocyte Cell Surface Impact Fc gamma Receptor-Dependent Mechanisms. Frontiers in Immunology, 10, 223. https://doi.org/10.3389/fimmu.2019.00223
3. Moldovan, I., Galon, J., Maridonneau-Parini, I., Roman Roman, S., Mathiot, C., Fridman, W. H., & Sautes-Fridman, C. (1999). Regulation of production of soluble Fc gamma receptors type III in normal and pathological conditions. Immunology Letters, 68(1), 125-134. https://doi.org/10.1016/s0165-2478(99)00041-3
4. Uniprot (P08637)
5. Uniprot (O75015)
6. Sivori, S., Pende, D., Quatrini, L., Pietra, G., Della Chiesa, M., Vacca, P., Tumino, N., Moretta, F., Mingari, M. C., Locatelli, F., & Moretta, L. (2021). NK cells and ILCs in tumor immunotherapy. Molecular Aspects of Medicine, 80, 100870. https://doi.org/10.1016/j.mam.2020.100870
7. Muntasell, A., Ochoa, M. C., Cordeiro, L., Berraondo, P., Lopez-Diaz de Cerio, A., Cabo, M., Lopez-Botet, M., & Melero, I. (2017). Targeting NK-cell checkpoints for cancer immunotherapy. Current Opinion in Immunology, 45, 73-81. https://doi.org/10.1016/j.coi.2017.01.003
Long Name
Fc gamma Receptor III
Alternate Names
FcgRIII
Gene Symbol
FCGR3A
Additional Fc gamma RIII (CD16) Products
Product Documents for Fc gamma RIII (CD16) Antibody - BSA Free
Product Specific Notices for Fc gamma RIII (CD16) Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...