Skip to main content

Ferritin Heavy Chain Antibody (1Q10I7)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-15766

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-15766-100ul
NBP3-15766-20ul

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 1Q10I7

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Ferritin Heavy Chain (P02794). MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNA

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Ferritin Heavy Chain Antibody (1Q10I7)

Western Blot: Ferritin Heavy Chain Antibody (1Q10I7) [NBP3-15766]

Western Blot: Ferritin Heavy Chain Antibody (1Q10I7) [NBP3-15766]

Western Blot: Ferritin Heavy Chain Antibody (1Q10I7) [NBP3-15766] - Western blot analysis of extracts of various cell lines, using Ferritin Heavy Chain antibody (NBP3-15766) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Western Blot: Ferritin Heavy Chain Antibody (1Q10I7) [NBP3-15766]

Western Blot: Ferritin Heavy Chain Antibody (1Q10I7) [NBP3-15766]

Western Blot: Ferritin Heavy Chain Antibody (1Q10I7) [NBP3-15766] - Western blot analysis of extracts of U-251MG cells, using Ferritin Heavy Chain antibody (NBP3-15766) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
Ferritin Heavy Chain Antibody (1Q10I7)

Immunocytochemistry/ Immunofluorescence: Ferritin Heavy Chain Antibody (1Q10I7) [Ferritin Heavy Chain] -

Immunocytochemistry/ Immunofluorescence: Ferritin Heavy Chain Antibody (1Q10I7) [Ferritin Heavy Chain] - Confocal imaging of paraffin-embedded Rat liver tissue using Ferritin Heavy Chain Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.

Applications for Ferritin Heavy Chain Antibody (1Q10I7)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:1000 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Ferritin Heavy Chain

This gene encodes the heavy subunit of ferritin, the major intracellular iron storage protein in prokaryotes and eukaryotes. It is composed of 24 subunits of the heavy and light ferritin chains. Variation in ferritin subunit composition may affect the rates of iron uptake and release in different tissues. A major function of ferritin is the storage of iron in a soluble and nontoxic state. Defects in ferritin proteins are associated with several neurodegenerative diseases. This gene has multiple pseudogenes. Several alternatively spliced transcript variants have been observed, but their biological validity has not been determined. [provided by RefSeq, Jul 2008]

Alternate Names

apoferritin, Cell proliferation-inducing gene 15 protein, Ferritin H subunit, ferritin heavy chain, ferritin, heavy polypeptide 1, FHC, FTHEC 1.16.3.1, FTHL6MGC104426, PIG15, placenta immunoregulatory factor, PLIF, proliferation-inducing protein 15

Gene Symbol

FTH1

Additional Ferritin Heavy Chain Products

Product Documents for Ferritin Heavy Chain Antibody (1Q10I7)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Ferritin Heavy Chain Antibody (1Q10I7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...