G protein alpha inhibitor 1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-38583

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-38583-100ul
NBP3-38583-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all G protein alpha inhibitor 1 Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 50-150 of human G protein alpha inhibitor 1 (NP_002060.4).

Sequence:
VKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLND

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for G protein alpha inhibitor 1 Antibody

G protein alpha inhibitor 1 Antibody

Western Blot: G protein alpha inhibitor 1 Antibody [NBP3-38583] -

Western Blot: G protein alpha inhibitor 1 Antibody [NBP3-38583] - Western blot analysis of various lysates using G protein alpha inhibitor 1 Rabbit pAb at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.

Applications for G protein alpha inhibitor 1 Antibody

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: G protein alpha inhibitor 1

Guanine nucleotide-binding proteins (G proteins) form a large family of signal-transducing molecules. They are found as heterotrimers made up of alpha, beta, and gamma subunits. Members of the G protein family have been characterized most extensively on the basis of the alpha subunit, which binds guanine nucleotide, is capable of hydrolyzing GTP, and interacts with specific receptor and effector molecules. The G protein family includes Gs (MIM 139320) and Gi, the stimulatory and inhibitory GTP-binding regulators of adenylate cyclase; Go, a protein abundant in brain (GNAO1; MIM 139311); and transducin-1 (GNAT1; MIM 139330) and transducin-2 (GNAT2; MIM 139340), proteins involved in phototransduction in retinal rods and cones, respectively (Sullivan et al., 1986 [PubMed 3092218]; Bray et al., 1987 [PubMed 3110783]). Suki et al. (1987) [PubMed 2440724] concluded that the human genome contains at least 3 nonallelic genes for alpha-i-type subunits of G protein; see, e.g, GNAI2 (MIM 139360), GNAI3 (MIM 139370), and GNAIH (MIM 139180).[supplied by OMIM]

Alternate Names

Adenylate cyclase-inhibiting G alpha protein, Gi, Gi1 protein alpha subunit, guanine nucleotide binding protein (G protein), alpha inhibiting activitypolypeptide 1, guanine nucleotide-binding protein G(i) subunit alpha-1

Gene Symbol

GNAI1

Additional G protein alpha inhibitor 1 Products

Product Documents for G protein alpha inhibitor 1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for G protein alpha inhibitor 1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.