gamma Catenin Antibody (9O2K8)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16344

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16344-100ul
NBP3-16344-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9O2K8

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all gamma Catenin Antibodies »

Product Summary for gamma Catenin Antibody (9O2K8)

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 15-115 of human gamma Catenin (P14923). EWQQTYTYDSGIHSGANTCVPSVSSKGIMEEDEACGRQYTLKKTTTYTQGVPPSQGDLEYQMSTTARAKRVREAMCPGVSGEDSSLLLATQVEGQATNLQR

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for gamma Catenin Antibody (9O2K8)

Western Blot: gamma Catenin Antibody (9O2K8) [NBP3-16344]

Western Blot: gamma Catenin Antibody (9O2K8) [NBP3-16344]

Western Blot: gamma Catenin Antibody (9O2K8) [NBP3-16344] - Western blot analysis of extracts of various cell lines, using gamma Catenin Rabbit mAb (NBP3-16344) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.
Immunocytochemistry/ Immunofluorescence: gamma Catenin Antibody (9O2K8) [NBP3-16344]

Immunocytochemistry/ Immunofluorescence: gamma Catenin Antibody (9O2K8) [NBP3-16344]

Immunocytochemistry/Immunofluorescence: gamma Catenin Antibody (9O2K8) [NBP3-16344] - Immunofluorescence analysis of NIH-3T3 cells using gamma Catenin Rabbit mAb (NBP3-16344) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: gamma Catenin Antibody (9O2K8) [NBP3-16344]

Immunohistochemistry-Paraffin: gamma Catenin Antibody (9O2K8) [NBP3-16344]

Immunohistochemistry-Paraffin: gamma Catenin Antibody (9O2K8) [NBP3-16344] - Immunohistochemistry of paraffin-embedded mouse testis using gamma Catenin Rabbit mAb (NBP3-16344) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
View 4 more images

Applications for gamma Catenin Antibody (9O2K8)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: gamma Catenin

Catenin gamma, also known as Junction Plakoglobin, is a common junctional plaque protein. It is a cytoplasmic protein with soluble and membrane-associated forms. The presence of Catenin gamma in both the desmosomes and in the intermediate junctions suggests it has a role in the structure and Function of submembranous plaques.

Alternate Names

catenin (cadherin-associated protein), gamma (80kD), catenin (cadherin-associated protein), gamma 80kDa, Catenin gamma, Desmoplakin III, desmoplakin-3, DP3CTNNG, DPIII, gamma-catenin, junction plakoglobin, PDGBARVD12, PKGB

Gene Symbol

JUP

Additional gamma Catenin Products

Product Documents for gamma Catenin Antibody (9O2K8)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for gamma Catenin Antibody (9O2K8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.