GAPDH Antibody (CL3265)

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-59025

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-59025
NBP2-59025-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Validated:

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 Clone # CL3265

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all GAPDH Antibodies »

Product Summary for GAPDH Antibody (CL3265)

Immunogen

This GAPDH antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIIS

Epitope

ERDPSKIKWGDAGAE

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1

Theoretical MW

36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for GAPDH Antibody (CL3265)

Western Blot: GAPDH Antibody (CL3265) [NBP2-59025]

Western Blot: GAPDH Antibody (CL3265) [NBP2-59025]

Western Blot: GAPDH Antibody (CL3265) [NBP2-59025] - Theoretical molecular weight: 36 kDa. Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-GAPDH antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Immunohistochemistry-Paraffin: GAPDH Antibody (CL3265) [NBP2-59025]

Immunohistochemistry-Paraffin: GAPDH Antibody (CL3265) [NBP2-59025]

Immunohistochemistry-Paraffin: GAPDH Antibody (CL3265) [NBP2-59025] - Staining of human skeletal muscle shows moderate cytoplasmic and strong nuclear immunoreactivity in muscle fibers.
Western Blot: GAPDH Antibody (CL3265) [NBP2-59025]

Western Blot: GAPDH Antibody (CL3265) [NBP2-59025]

Western Blot: GAPDH Antibody (CL3265) [NBP2-59025] - Analysis in human cell line HeLa, human cell line HEK 293, human cell line A-431, human cell line HepG2, mouse cell line NIH-3T3 and rat cell line NBT-II. Theoretical molecular weight: 36 kDa.
View 4 more images

Applications for GAPDH Antibody (CL3265)

Application
Recommended Usage

Immunohistochemistry

1:5000 - 1:10000

Immunohistochemistry-Paraffin

1:5000 - 1:10000

Western Blot

1 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GAPDH

Glyceraldehyde 3-Phosphate Dehydrogenase (GAPDH) is a ubiquitous enzyme involved in glycolysis, converting glyceraldehyde-3-phosphate into 1,3 diphosphoglycerate. This constitutively expressed, homotetramer protein can be found in the nucleus and cytoplasm, and the monomer has a theoretical molecular weight of 36 kDa. Known as a housekeeping gene, GAPDH routinely serves as a control for real-time PCR (RT-PCR) and as a loading control for Western Blots (1-3). In addition to its role in glycolysis, GAPDH has multiple cellular functions including membrane trafficking, transcription activation, apoptosis, DNA repair, and has been implicated in various pathologies such as cancer and neurodegenerative diseases including Alzheimer's and Huntington's (4,5).

References

1) Barber RD, Harmer DW, Coleman RA, Clark BJ. (2005) GAPDH as a housekeeping gene: analysis of GAPDH mRNA expression in a panel of 72 human tissues. Physiol Genomics. 21(3):389-95. PMID: 15769908

2) Jia Y, Takimoto K. (2006) Mitogen-activated protein kinases control cardiac KChIP2 gene expression. Circ Res. 98(3):386-93. PMID: 16385079

3) Godsel LM, Hsieh SN, Amargo EV, Bass AE, Pascoe-McGillicuddy LT, Huen AC, Thorne ME, Gaudry CA, Park JK, Myung K, Goldman RD, Chew TL, Green KJ. (2005) Desmoplakin assembly dynamics in four dimensions: multiple phases differentially regulated by intermediate filaments and actin. J Cell Biol. 171(6):1045-59. PMID: 16365169

4) Sirover MA1. (1999) New insights into an old protein: the functional diversity of mammalian glyceraldehyde-3-phosphate dehydrogenase. Biochim Biophys Acta. 1432(2): 159-84. PMID: 10407139

5) Tristan C, Shahani N, Sedlak TW, Sawa A. (2011) The diverse functions of GAPDH: views from different subcellular compartments. Cell Signal. 23(2):317-23. PMID: 20727968

Long Name

Glyceraldehyde-3-phosphate Dehydrogenase

Alternate Names

G3PDH

Gene Symbol

GAPDH

Additional GAPDH Products

Product Documents for GAPDH Antibody (CL3265)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for GAPDH Antibody (CL3265)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.