Glutathione S-Transferase pi 1/GSTP1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-10136

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-10136-100ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all Glutathione S-Transferase pi 1/GSTP1 Antibodies »

Product Summary for Glutathione S-Transferase pi 1/GSTP1 Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of mouse Glutathione S-Transferase pi 1/GSTP1 (NP_861461.1). Peptide sequence LIHQVLAPGCLDNFPLLSAYVARLSARPKIKAFLSSPEHVNRPINGNGKQ

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Glutathione S-Transferase pi 1/GSTP1 Antibody

Western Blot: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP3-10136]

Western Blot: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP3-10136]

Western Blot: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP3-10136] - Western blot analysis of Glutathione S-Transferase pi 1/GSTP1 in Mouse Spleen lysates. Antibody dilution at 1ug/ml

Applications for Glutathione S-Transferase pi 1/GSTP1 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Glutathione S-Transferase pi 1/GSTP1

GSTP1 (glutathione-S-transferase, pi 1), also called GST3/DFN7, which is located on chromosome 11q13 , is a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. GSTP1 act like a tumor suppressor gene, which when inactivated leads to tumor growth, and the -class glutathione S-transferase is commonly inactivated by somatic CpGisland hypermethylation in cancers of the prostate, liver, and breast. Methylation of regulatory sequences at the GSTP1 gene locus is found in the vast majority (>90%) of prostate carcinomas and is associated with transcriptional down-regulation.

Alternate Names

DFN7, FAEES3, Glutathione STransferase pi 1, GSTP1

Gene Symbol

GSTP1

Additional Glutathione S-Transferase pi 1/GSTP1 Products

Product Documents for Glutathione S-Transferase pi 1/GSTP1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Glutathione S-Transferase pi 1/GSTP1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.