Histone 3 H2a Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-10092

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-10092-100ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all Histone 3 H2a Antibodies »

Product Summary for Histone 3 H2a Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human Histone 3 H2a (NP_254280.1). Peptide sequence GRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYL

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

14 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Histone 3 H2a Antibody

Western Blot: Histone 3 H2a Antibody [NBP3-10092]

Western Blot: Histone 3 H2a Antibody [NBP3-10092]

Western Blot: Histone 3 H2a Antibody [NBP3-10092] - Western blot analysis of Histone 3 H2a in Human Jurkat Whole Cell lysates. Antibody dilution at 1ug/ml

Applications for Histone 3 H2a Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Histone 3 H2a

Histone 3 H2a is 130 amino acids long, weighs approximately 15 kDa, and is part of a group of basic nuclear proteins called histones, which are responsible for nucleosome structure of the chromosomal fiber in eukaryotes. Current studies are being done on several diseases and disorders including systemic lupus erythematosus, lupus erythematosus, x inactivation, riddle syndrome, and immunodeficiency. Histone 3 H2a has also been shown to have interactions with TCL1A, DNTTIP2, CHD1L, CBX5, and RPS6KA5 in pathways such as the systemic lupus erythematosus pathway.

Alternate Names

histone 3, H2a, histone cluster 3, H2a, histone H2A type 3, MGC3165

Gene Symbol

H2AC25

Additional Histone 3 H2a Products

Product Documents for Histone 3 H2a Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Histone 3 H2a Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.