Histone H3 [ac Lys27] Antibody (2V10N10)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-15933

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-15933-100ul
NBP3-15933-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Biological Validation

Species Reactivity

Human, Mouse, Rat

Applications

Chromatin Immunoprecipitation (ChIP), Dot Blot, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunoprecipitation, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 2V10N10

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Histone H3 Antibodies »

Product Specifications

Immunogen

A synthetic acetylated peptide around K27 of human Histone H3 (P68431). MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY

Reactivity Notes

Other (Wide Range Predicted)

Modification

ac Lys27

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Histone H3 [ac Lys27] Antibody (2V10N10)

Histone H3 [ac Lys27] Antibody (2V10N10)

Immunoprecipitation: Histone H3 [ac Lys27] Antibody-Histone H3 [ac Lys27] Antibody (2V10N10)-[NBP3-15933] -Analysis of 600 μg extracts of Hela TSA cells using 5 μg Acetyl-Histone H3-K27 antibody. Western blot was performed from the immunoprecipitate using Acetyl-Histone H3-K27 antibody at a dilution of 1:50000.

Immunoprecipitation: Histone H3 [ac Lys27] Antibody-Histone H3 [ac Lys27] Antibody (2V10N10)-[NBP3-15933] -
Histone H3 [ac Lys27] Antibody (2V10N10)

Chromatin Immunoprecipitation: Histone H3 [ac Lys27] Antibody (2V10N10)- [NBP3-15933] -

Chromatin Immunoprecipitation: Histone H3 [ac Lys27] Antibody (2V10N10)- [NBP3-15933] - Analysis of extracts of HeLa cells, using Acetyl-Histone H3-K27 antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
Histone H3 [ac Lys27] Antibody (2V10N10)

Dot Blot-Histone H3 [ac Lys27] Antibody (2V10N10)-NBP3-15933-

Dot Blot-Histone H3 [ac Lys27] Antibody (2V10N10)-NBP3-15933- Analysis of all sorts of peptides using Acetyl-Histone H3-K27 Rabbit mAb at 1:200000 dilution.
View 10 more images

Applications for Histone H3 [ac Lys27] Antibody (2V10N10)

Application
Recommended Usage

Chromatin Immunoprecipitation (ChIP)

1:50 - 1:200

Dot Blot

1:500 - 1:2000

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Immunoprecipitation

0.5μg-4μg antibody for 200μg-400μg extracts of whole cells

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.05% Proclin 300

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Histone H3

Chromatin is an arrangement of DNA and proteins which form chromosomes. Chromatin is formed from nucleosomes, which are comprised of a set of four histone proteins (H2A, H2B, H3, H4) wrapped with DNA. Chromatin is very dynamic, where post-translational modifications can regulate DNA to be copied, transcribed, or repaired.

Histones are nuclear proteins responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Changes in chromatin structure play a large role in the regulation of transcription. The chromatin fibers are compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures.

Common histone modifications include methylation of lysine and arginine, acetylation of lysine, phosphorylation of threonine and serine, and sumoylation, biotinylation, and ubiquitylation of lysine. Posttranslational modifications such as acetylation of core histones regulates gene expression, thus altering protein function and regulation (1). Histone H3 is primarily acetylated at lysines 9, 14, 18, and 23 and have a theoretical molecular weight of 15 kDa. Acetylation at lysine 9 and 14 appears to control histone deposition, chromatin assembly and active transcription. Methylation of arginine residues within histone H3 has also been linked to transcription regulation. Histone H3 has been linked to various types of cancer as a biomarker through the aberrant expression of histone deacetylase (HDAC) enzymes and changes to chromatins (2-4).

References

1. Zhang, Y. X., Akumuo, R. C., Espana, R. A., Yan, C. X., Gao, W. J., & Li, Y. C. (2018). The histone demethylase KDM6B in the medial prefrontal cortex epigenetically regulates cocaine reward memory. Neuropharmacology, 141, 113-125. doi:10.1016/j.neuropharm.2018.08.030

2. Nandakumar, V., Hansen, N., Glenn, H. L., Han, J. H., Helland, S., Hernandez, K, ...Meldrum, D. R. (2016). Vorinostat differentially alters 3D nuclear structure of cancer and non-cancerous esophageal cells. Sci Rep, 6, 30593. doi:10.1038/srep30593

3. Zhou, M., Li, Y., Lin, S., Chen, Y., Qian, Y., Zhao, Z., & Fan, H. (2019). H3K9me3, H3K36me3, and H4K20me3 Expression Correlates with Patient Outcome in Esophageal Squamous Cell Carcinoma as Epigenetic Markers. Dig Dis Sci, 64(8), 2147-2157. doi:10.1007/s10620-019-05529-2

4. Li, Y., Guo, D., Sun, R., Chen, P., Qian, Q., & Fan, H. (2019). Methylation Patterns of Lys9 and Lys27 on Histone H3 Correlate with Patient Outcome in Gastric Cancer. Dig Dis Sci, 64(2), 439-446. doi:10.1007/s10620-018-5341-8

Alternate Names

H3F3A

Gene Symbol

H3C14

Additional Histone H3 Products

Product Documents for Histone H3 [ac Lys27] Antibody (2V10N10)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Histone H3 [ac Lys27] Antibody (2V10N10)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.