HMGN1/HMG14 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-03219

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-03219-100ul
NBP3-03219-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all HMGN1 Antibodies »

Product Summary for HMGN1/HMG14 Antibody - BSA Free

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human HMGN1/HMG14 (NP_004956.5). MPKRKVSSAEGAAKEEPKRRSARLSAKPPAKVEAKPKKAAAKDKSSDKKVQTKGKRGAKGKQAEVANQETKEDLPAENGETKTEESPASDEAGEKEAKSD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

10 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for HMGN1/HMG14 Antibody - BSA Free

Immunohistochemistry-Paraffin: HMGN1/HMG14 Antibody - BSA Free [NBP3-03219]

Immunohistochemistry-Paraffin: HMGN1/HMG14 Antibody - BSA Free [NBP3-03219]

Immunohistochemistry-Paraffin: HMGN1/HMG14 Antibody [NBP3-03219] - Immunohistochemistry of paraffin-embedded rat brain using HMGN1/HMG14 antibody (NBP3-03219) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: HMGN1/HMG14 Antibody - BSA Free [NBP3-03219]

Immunohistochemistry-Paraffin: HMGN1/HMG14 Antibody - BSA Free [NBP3-03219]

Immunohistochemistry-Paraffin: HMGN1/HMG14 Antibody [NBP3-03219] - Immunohistochemistry of paraffin-embedded mouse testis using HMGN1/HMG14 antibody (NBP3-03219) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Applications for HMGN1/HMG14 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50-1:200
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS with 50% glycerol, pH7.3.

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: HMGN1

HMGNs are proteins that bind chromatin effectively reducing the compaction of the chromatin fiber and enhancing access to DNA regulatory sequences. Members of this family have a conserved chromatin binding domain which is phosphorylated during mitosis. The sequence immunized is conserved in several species. As such, this reagent is designed as a universal reagent for the detection of all phosphorylated HMGN proteins. The High Mobility Group (HMG) proteins were originally isolated from mammalian cells and were named according to their electrophoretic mobility in polyacrylamide gels. HMGs were arbitrarily classed as a specific type of nonhistone proteins based on the observation that they are ubiquitous to mammalian cells, that they share certain physical properties, and that they are associated with isolated chromatin. HMG proteins and are now subdivided into 3 families: the HMGB (formerly HMG-1/-2) family, the HMGN (formerly HMG-14/-17) family, and the HMGA (formerly HMG-I/Y/C) family. Each HMG family has a characteristic functional sequence motif. The functional motif of the HMGB family is called the "HMG-box;" that of the HMGN family, the "nucleosomal binding domain;" and that of the HMGA family, the "AT-hook." The functional motifs characteristic of these canonical HMGs are widespread among nuclear proteins in a variety of organisms. Proteins containing any of these functional motifs embedded in their sequence are known as "HMG motif proteins."

Long Name

High Mobility Group Nucleosome Binding Domain 1

Alternate Names

HMG14

Gene Symbol

HMGN1

Additional HMGN1 Products

Product Documents for HMGN1/HMG14 Antibody - BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for HMGN1/HMG14 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.