HSP20/HSPB6 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-32027

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-32027
NBP2-32027-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all HSP20/HSPB6 Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: DQRFGEGLLEAELAALCPTTLAPYYLRAPSVALPVAQVPTDPGHFSVLLDVK

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (88%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HSP20/HSPB6 Antibody

Western Blot: HSP20/HSPB6 Antibody [NBP2-32027]

Western Blot: HSP20/HSPB6 Antibody [NBP2-32027]

Western Blot: HSP20/HSPB6 Antibody [NBP2-32027] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human Skeletal muscle tissue
Immunohistochemistry-Paraffin: HSP20/HSPB6 Antibody [NBP2-32027]

Immunohistochemistry-Paraffin: HSP20/HSPB6 Antibody [NBP2-32027]

Immunohistochemistry-Paraffin: HSP20/HSPB6 Antibody [NBP2-32027] - Staining in human skeletal muscle and tonsil tissues using anti-HSPB6 antibody. Corresponding HSPB6 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: HSP20/HSPB6 Antibody [NBP2-32027]

Immunohistochemistry-Paraffin: HSP20/HSPB6 Antibody [NBP2-32027]

Immunohistochemistry-Paraffin: HSP20/HSPB6 Antibody [NBP2-32027] - Staining of human skeletal muscle shows high expression.
View 1 more images

Applications for HSP20/HSPB6 Antibody

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HSP20/HSPB6

Hsp20 is a small heat shock protein related to Hsp25, Hsp27 and may form different hetercomplexes with these proteins. The specific physiological function of Hsp20 is not yet known. It is distributed ubiquitously in tissues, but is found in higher levels in skeletal, smooth and heart muscle. Under normal conditions, Hsp20 is diffusely distributed in the cytosol, but under heat stress conditions, it translocates to the nucleus. Unlike other heat shock proteins the amount of Hsp20 does not increase after heat shock. The Hsp20 was demonstrated to constitute up to 1.3% of the total cellular protein in vertebrate tissues, especially in muscle, and its expression is related to muscle contraction, specifically in slow-twitch muscle. Hsp20 may form different heterocomplexes with other Hsp's, such as alpha-crystalline and Hsp25. Phosphorylated form of Hsp20 is proposed to interact with monomeric actin whereas dephosphorylated form binds polymeric actin filaments. In normal conditions Hsp20 is diffusely disturbed in cytosol but under the heat stress it undergoes translocation to membrane fraction.

Long Name

Heat Shock Protein 20

Alternate Names

HSPB6

Gene Symbol

HSPB6

UniProt

O14558 (Human)

Additional HSP20/HSPB6 Products

Product Documents for HSP20/HSPB6 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for HSP20/HSPB6 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.