Hydroxyacid Oxidase-1/HAO-1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-14080

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-14080-25ul
NBP2-14080
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human, Canine

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all Hydroxyacid Oxidase-1/HAO-1 Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: QHAKSVLPKSIYDYYRSGANDEETLADNIAAFSRWKLYPRMLRNVAETDLSTSVLGQRVSMPICVGATAMQRMAHVDGELATVR

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (88%). Reactivity reported in scientific literature (PMID: 24648543). Canine reactivity reported from a verified customer review.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Hydroxyacid Oxidase-1/HAO-1 Antibody

Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080]

Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080]

Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080] - Analysis in human liver and endometrium tissues using NBP2-14080 antibody. Corresponding HAO1 RNA-seq data are presented for the same tissues.
Western Blot: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080]

Western Blot: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080]

Western Blot: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080] - Analysis in human liver tissue.
Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080]

Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080]

Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080] - Hydroxyacid Oxidase-1/HAO-1 antibody was used on canine paraffin-embedded liver tissue at a concentration of 20ug/mL and left at 4C overnight. HIER was performed in Tris/EDTA buffer for two hours at 75C. Image from verified customer review.
View 4 more images

Applications for Hydroxyacid Oxidase-1/HAO-1 Antibody

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000-1:2500

Western Blot

0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reviewed Applications

Read 3 reviews rated 3.7 using NBP2-14080 in the following applications:

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Hydroxyacid Oxidase-1/HAO-1

HAO1 is one of three related genes that have 2-hydroxyacid oxidase activity yet differ in encoded protein amino acid sequence, tissue expression and substrate preference. Subcellular location of the encoded protein is the peroxisome. Specifically, this gene is expressed primarily in liver and pancreas and the encoded protein is most active on glycolate, a two-carbon substrate. The protein is also active on 2-hydroxy fatty acids. The transcript detected at high levels in pancreas may represent an alternatively spliced form or the use of a multiple near-consensus upstream polyadenylation site. [provided by RefSeq]

Alternate Names

GOX, HAO-1, HAO1, HAOX1, Hydroxyacid Oxidase1

Gene Symbol

HAO1

Additional Hydroxyacid Oxidase-1/HAO-1 Products

Product Documents for Hydroxyacid Oxidase-1/HAO-1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Hydroxyacid Oxidase-1/HAO-1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.